Details for Arabidopsis Locus AT3G19615

Position : Chr3 ( 5`- 6814966 .. 6815403 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19615

Protein [Map View]
MEGLIPYLIHAIKKDHKPDHQRYRSISVGSSRSYRPLMMGQDGSSSMQGSSHRRTRSDYNPHVIMDKFDQRSSGFGQEFV
NKDSSSQKIATKT*

DNA
ATGGAGGGGTTAATTCCATATCTGATTCATGCTATCAAGAAAGACCACAAGCCTGATCATCAGAGGTATCGATCGATATC
TGTGGGATCGAGCCGAAGCTATCGACCTTTAATGATGGGACAAGACGGCTCTTCTTCAATGCAGGGATCTTCTCACCGTC
GAACTAGATCAGACTATAATCCACATGTTATAATGGATAAGTTTGATCAGAGATCATCAGGTTTTGGTCAAGAATTTGTG
AATAAAGATTCTTCTTCTCAGAAAATAGCAACAAAGACTTAG