Details for Arabidopsis Locus AT3G19610

Position : Chr3 ( 5`- 6812493 .. 6814719 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19610

Protein [Map View]
MQQIEKRSLLCSFLSVFHLIHLQALLLEMAELRSGVLFKLLEEMGVGKVRRDVDHRPVLLQIRCIIPVLAAGGLWPNKGF
FLRITDSTHSIYVSLPREENDLVLYDKLQIGQLIFVEKLEFAYPVPMIKGIRPTPGRRACTGDPIDLIPKERIEKFCVGL
SDIEENYDHQVKKPRRTRWNNSSVSELNFTDLGLSKNLSSVMEEKDDTESMISSCSSSFSSAARRRSWIGSADNRKRRDS
LDPSMIKNHDHDTKHVSRARSSSATSPSLSIRSYGGIEEKSSSRTRRRDVVVSPSPRWSKSLSYGSRSNKSKNLLPPKSN
TFESSDPISRKRSWTETEILWDSLPPKVVNLGKEILRQRDTAIRAASQALLEASAAERLLKCLRSYSELSDRRNQHQENQ
QPPIQDFLSFQDELSKSRLIIQSLSTEKTEHCNANIVKTGDERREKATQWIKSALATDLKLVSLSASKPTQSPGRKGLTL
IAQESDNREGNASESNSRLGEIKERLSRASSELRNWLKEEGRSWYLNRVEKYLDEISNGTKWREMRSEEVGETMYQIKRV
SDWLDTIVKGEEDEEEKMVMMMMSESETEACGRVRNKIYRILLKHVETTSLLSHQRSTSLMSHHQQQQHEQHLFQKTMSL
*

DNA
ATGCAACAGATTGAGAAACGTAGCCTTCTCTGTTCGTTTCTCTCTGTGTTTCATCTGATACATTTACAAGCATTGCTTCT
TGAAATGGCAGAATTAAGATCAGGTGTTCTTTTCAAGCTTCTAGAAGAAATGGGAGTCGGGAAAGTGCGAAGAGACGTCG
ATCACAGACCCGTTTTGCTGCAAATAAGATGCATAATCCCTGTGTTAGCAGCTGGAGGGTTATGGCCAAACAAAGGTTTC
TTCTTGAGGATAACAGATTCGACACATTCAATATATGTCTCATTGCCACGAGAAGAGAACGATCTTGTTCTCTACGACAA
GTTACAAATCGGGCAATTGATATTCGTCGAGAAGCTTGAATTTGCTTATCCAGTTCCCATGATCAAAGGCATTAGACCAA
CACCTGGCCGAAGGGCTTGCACCGGTGATCCAATCGATCTAATCCCTAAAGAACGGATCGAAAAGTTCTGTGTCGGTCTA
TCGGATATCGAAGAAAACTACGATCACCAAGTGAAGAAGCCAAGAAGAACTAGATGGAATAACTCAAGCGTCTCTGAGTT
AAACTTTACAGATTTAGGGTTATCGAAAAATCTTTCGAGTGTTATGGAAGAAAAGGATGATACAGAGTCAATGATTTCAA
GTTGCTCTTCGTCTTTTTCTTCAGCAGCTAGGAGGAGAAGCTGGATAGGCTCGGCTGATAATAGGAAGAGAAGAGATTCA
TTAGATCCATCCATGATTAAGAATCATGATCATGACACTAAACATGTTTCAAGAGCTCGAAGTTCTTCTGCTACTTCACC
TTCTCTTTCTATCCGAAGCTATGGAGGGATAGAGGAGAAGTCAAGTAGTAGAACAAGAAGAAGAGATGTTGTGGTTTCAC
CATCTCCAAGATGGTCTAAAAGCTTAAGCTATGGAAGTAGAAGTAATAAGAGTAAAAACCTTCTTCCACCTAAAAGCAAT
ACCTTTGAATCCTCAGATCCGATATCAAGGAAACGAAGCTGGACAGAGACAGAGATTCTCTGGGATTCACTTCCTCCAAA
AGTTGTAAATCTCGGAAAGGAAATTCTGAGACAGAGAGATACGGCTATTAGAGCTGCCTCACAAGCTTTGTTAGAGGCTT
CAGCTGCTGAAAGATTGCTCAAATGTCTAAGGTCATACTCTGAGCTTTCAGACAGGAGAAACCAACATCAAGAAAATCAA
CAGCCACCAATCCAAGATTTCTTGAGTTTCCAGGATGAGTTAAGCAAGAGCAGGCTCATCATTCAATCACTATCAACTGA
AAAAACAGAGCACTGCAACGCAAACATAGTCAAAACAGGAGATGAGAGACGCGAAAAGGCGACTCAGTGGATCAAATCAG
CATTGGCTACCGATCTCAAACTGGTTTCTTTATCCGCAAGCAAGCCTACACAGAGCCCCGGGAGAAAGGGTCTTACCCTA
ATTGCTCAAGAAAGTGATAACCGTGAAGGTAACGCAAGCGAAAGCAACTCAAGATTGGGAGAGATAAAGGAGAGGTTAAG
CAGAGCATCGAGCGAACTCAGAAACTGGCTTAAGGAAGAAGGAAGAAGTTGGTACCTAAACCGTGTTGAGAAGTATTTAG
ATGAGATCAGCAATGGAACAAAGTGGAGAGAGATGAGGAGTGAAGAAGTAGGGGAAACAATGTATCAGATAAAGCGAGTG
AGTGATTGGTTAGACACCATTGTTAAAGGAGAAGAAGATGAGGAAGAAAAGATGGTGATGATGATGATGTCAGAGTCTGA
AACAGAGGCTTGTGGTAGAGTGAGGAACAAGATTTATAGGATTCTTTTGAAACATGTTGAGACAACTTCTTTGTTAAGTC
ATCAACGAAGTACCAGTCTCATGTCTCATCATCAACAACAACAACACGAACAACACTTGTTCCAAAAGACAATGTCACTT
TAG