Details for Arabidopsis Locus AT3G19590

Position : Chr3 ( 5`- 6805631 .. 6808593 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19590

Protein [Map View]
MTTVTPSAGRELSNPPSDGISNLRFSNNSDHLLVSSWDKRVRLYDVSTNSLKGEFLHGGAVLDCCFHDDFSGFSVGADYK
VRRIVFNVGKEDILGTHDKAVRCVEYSYAAGQVITGSWDKTVKCWDPRGASGPERTQVGTYLQPERVYSMSLVGHRLVVA
TAGRHVNIYDLRNMSQPEQRRESSLKYQTRCVRCYPNGTGYALSSVEGRVAMEFFDLSEAAQAKKYAFKCHRKSEAGRDI
VYPVNSIAFHPIYGTFATGGCDGFVNIWDGNNKKRLYQYSKYPTSISALSFSRDGQLLAVASSYTFEEGEKSQEPEAIFV
RSVNEIEVKPKPKVYPNPAA*

DNA
ATGACGACTGTGACTCCGTCCGCCGGTCGTGAGCTCTCGAATCCGCCGTCCGACGGCATTTCTAATCTCCGATTTTCTAA
TAACAGTGATCATCTCCTCGTTTCTTCATGGGATAAGCGTGTGAGATTGTATGATGTGAGCACCAATTCGTTGAAAGGAG
AGTTCTTACATGGCGGAGCAGTACTCGATTGCTGTTTTCACGATGACTTCTCCGGCTTCAGTGTTGGCGCTGATTACAAA
GTCCGACGGATTGTATTCAATGTCGGCAAAGAGGACATTTTGGGGACACATGACAAAGCAGTGCGATGTGTTGAGTATTC
TTACGCTGCGGGACAAGTGATCACTGGATCTTGGGATAAAACAGTTAAATGTTGGGATCCAAGAGGCGCTAGTGGGCCTG
AACGCACCCAAGTGGGAACATATTTGCAACCAGAACGTGTTTACTCTATGTCTCTTGTTGGACATCGTTTGGTAGTGGCT
ACAGCAGGAAGGCATGTAAACATCTATGATCTCAGAAATATGTCTCAGCCTGAGCAAAGAAGGGAGTCTTCACTGAAATA
CCAGACGAGATGTGTGCGTTGTTATCCTAATGGAACAGGCTATGCTCTTAGCTCTGTTGAAGGAAGGGTTGCAATGGAGT
TTTTTGATCTGTCAGAGGCTGCTCAAGCTAAAAAATATGCTTTCAAATGTCATCGGAAATCAGAGGCTGGAAGGGACATT
GTTTACCCTGTAAATTCCATTGCCTTCCATCCAATCTATGGCACCTTTGCAACTGGAGGCTGTGATGGTTTCGTCAACAT
TTGGGATGGTAACAACAAGAAGAGGCTATATCAGTACTCAAAGTATCCAACGAGTATCTCGGCACTGTCATTCAGTCGAG
ATGGTCAGCTGCTGGCTGTTGCTTCAAGTTACACATTTGAAGAGGGAGAGAAATCGCAAGAACCGGAGGCCATCTTTGTA
AGAAGCGTGAATGAAATCGAAGTGAAACCAAAACCGAAAGTATACCCGAATCCTGCGGCGTAG