Details for Arabidopsis Locus AT3G19570

Position : Chr3 ( 5`- 6797485 .. 6801740 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19570

Protein [Map View]
MVAAIPQGAAISNTDSKNPPPRDRQDKPQLTANNGGLQRRPRAAKNVPSRYLSPSPSHSTTTTTTTATSTSTSSSSSVIL
RSSKRYPSPLLSRTTNSASNLVYTPSSLPKRSQSVDRRRPSAVSDTRTEMSAATKMLITSTRSLSVSFQGEAFSFPISKK
KETATPVSHRKCTPERRRATPVRDQRENSKPVDQQLWPGASRRGSSESVVPNSLSRSVDSDSDDGRKLGSGFVGRSMLQH
SQSSRVSGDGRLNLGFVGGDGMLEMRDENKARQSTHPRLASSVSCDFTASDTDSVSSGSTNGAHECGSGEVSKTRSLPRN
GMASTKFWQETNSRLRRMQDPGSPQCSSPSSRISSISSKFSQSKRFSSDSPLTSSPRGMTSPIRGATRPASPSKLWATAT
SAPARTSSSPSRVRNGVSEQMNAYNRTLPSILCFSADIRRGKIGEDRVMDAHLLRLLYNRDLQWRFANARADSTLMVQRL
SAEKILWNAWVSISELRHSVTLKRIKLLLMRQKLKLASILKEQMCYLEEWSLLDRNHSNSLSGATEALKASTLRLPVSGK
AVVDIQDLKHAVSSAVDVMHAMVSSIFSLTSKVEEMNSVMAEMVNITGKEEVLLEQCQGFLTRVAAMQVTDCSMKTHIIQ
LSRL*

DNA
ATGGTGGCTGCGATTCCTCAAGGAGCAGCAATTTCCAACACCGACTCTAAGAATCCTCCACCTCGAGATCGGCAAGACAA
ACCTCAGCTCACAGCTAACAATGGCGGACTACAACGAAGACCTAGAGCTGCTAAAAATGTCCCCTCACGCTACTTATCCC
CTTCTCCTTCACATTCCACGACGACGACGACGACCACTGCTACATCTACTTCGACTTCGTCTTCTTCGTCTGTGATACTG
AGGTCTAGTAAGCGATATCCTTCCCCTTTGCTCTCTCGCACGACGAATTCTGCTTCTAATTTGGTTTATACGCCTTCCTC
GTTACCTAAACGGTCTCAATCGGTGGACCGTCGTCGTCCGTCGGCAGTTTCTGACACCCGAACGGAAATGTCGGCGGCGA
CGAAGATGCTTATCACTTCTACGAGGAGTTTATCTGTTTCCTTTCAAGGAGAGGCGTTTTCGTTTCCGATTAGTAAGAAG
AAGGAGACTGCCACGCCGGTTTCTCACCGGAAATGTACTCCGGAGCGGCGGAGAGCGACACCTGTTCGAGATCAGCGGGA
GAATTCAAAGCCGGTGGATCAGCAACTGTGGCCTGGTGCTTCTCGGAGGGGAAGTTCTGAATCTGTTGTGCCGAATTCGC
TTTCTAGAAGCGTGGATTCTGACAGTGATGATGGGAGGAAGCTTGGATCTGGCTTTGTGGGAAGGTCAATGTTGCAGCAT
TCGCAGAGTTCTAGGGTTTCTGGTGATGGGAGATTGAATTTAGGTTTTGTAGGAGGTGATGGAATGTTGGAAATGAGAGA
TGAGAACAAGGCAAGACAAAGCACACATCCAAGATTGGCTTCTAGCGTTTCGTGTGACTTTACTGCATCTGATACTGATA
GTGTTTCATCTGGTAGTACTAATGGTGCGCATGAATGTGGTTCTGGTGAGGTTTCTAAAACAAGGAGCTTGCCGCGTAAT
GGTATGGCTTCTACTAAATTCTGGCAAGAGACTAATAGCAGGTTAAGGCGGATGCAGGATCCTGGCTCACCTCAATGTTC
TAGCCCAAGTTCGAGAATCAGTAGTATCTCATCAAAGTTCAGTCAATCGAAACGGTTCTCTAGTGATAGTCCGTTGACAT
CATCTCCTCGTGGTATGACTTCTCCAATAAGGGGTGCTACTCGCCCTGCTTCACCAAGTAAGCTTTGGGCAACAGCTACA
TCAGCTCCAGCTAGGACATCATCTAGTCCTTCTCGAGTGAGAAATGGAGTTTCTGAACAAATGAATGCTTATAACCGCAC
CTTGCCTTCAATTCTTTGTTTCTCTGCTGATATTAGGAGGGGTAAAATTGGGGAGGATCGTGTTATGGATGCCCACTTGT
TGAGGCTTCTGTATAACCGTGATCTGCAGTGGCGGTTTGCCAATGCGAGGGCAGACTCCACTCTCATGGTACAAAGACTG
AGTGCAGAGAAAATCCTGTGGAATGCATGGGTATCAATCTCGGAATTGCGCCATTCTGTCACTCTGAAACGGATCAAGTT
GCTCTTGATGAGGCAGAAACTGAAACTAGCTTCCATCTTGAAGGAGCAGATGTGTTATCTAGAAGAATGGTCTCTTTTGG
ACAGAAATCACTCAAATTCTTTGTCAGGAGCAACTGAAGCCTTGAAAGCCAGCACACTTCGTCTTCCAGTTAGTGGTAAA
GCCGTGGTTGATATTCAAGATCTCAAGCATGCTGTTAGTTCAGCGGTTGATGTCATGCACGCTATGGTGTCTTCAATATT
CTCACTTACATCGAAGGTGGAGGAAATGAATTCAGTAATGGCAGAAATGGTGAATATCACTGGAAAAGAAGAGGTTTTGC
TCGAACAGTGTCAAGGATTCTTAACAAGAGTAGCAGCAATGCAGGTTACGGACTGCAGCATGAAGACGCACATAATACAA
CTTAGCCGGCTATAA