Details for Arabidopsis Locus AT3G19515

Position : Chr3 ( 5`- 6766668 .. 6771169 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19515

Protein [Map View]
MEKLKDFEKRLRESTEKSQNLKDYLGIIEFSKTSIETKELGADLIPRYFQFYTSHSNQAFDAYKDIIEAVDVNLTVRVQA
IRKLPLFCKDAPELVSKIIDVLVQCLAIDQQEQHEAVHETFMSLFQQDTLSDLINKLPEPRKLDLLEALAEISPHTTTLI
ASEMLPPIFELLKKYMPARNTVEKSDSRYVECLLYVFHHMAHKVPEATNSLCGYKVVPTQPSDRIGDDFSKLYKESTERL
INLEDLIKASVEQLVQEMSDHDKAYLLFDSMSGDDKAILYMKRQDTKTELRTCINILAMTEVLHAEVPSFIGDTNVVKLS
WKEATKPLAYTRALYTDLMYGIPPDIDAFHNFMDKLSEDLLNKLDMEGMCELEDDQVQALVGSSGLKQAQDTLPESRIFL
HENPKVPCLFWRIRESTLLKLVTSKSWKKFLGFIRDQLFHLICWAYAASDLVSATRIMRNWEVEYIPLCPWYLCSFCRPE
YLGEDENPEKEDDENPEKGHYCYGNDIEDCLLYIKQHGIPREICKKFDCKDWQPPNADDPHMHTTKLKSVRKIESMEEAL
LLLPHFPIGADLVVFKELWTVGEEIYYGPGTNSRGFRSYHAVIVSSIEIYKGEVVAICKMSNGTKVCDEGYVRVSLATTY
MVVGASPKKKEHVRATSKPMHLLSEFIIIDIDENEKEKEREREKETESEEENPEDNQKGNPEHNPKEKSEEMQYPDFGAS
KFHNSLNEHIMPDSDKSLGNVSGEEIKMVTEGLTSLSKFGEKGPQERMHEPVEIVERGKRPANEAGNDVGTKKARTESSG
CAHGI*

DNA
ATGGAGAAGCTTAAAGATTTTGAGAAGCGACTTAGAGAGTCTACAGAAAAGTCTCAGAATCTTAAAGATTATTTAGGGAT
TATCGAGTTCTCCAAGACGAGCATCGAGACCAAGGAGCTTGGAGCGGATCTGATTCCTCGGTACTTCCAGTTCTACACCA
GTCACTCAAACCAAGCTTTTGATGCGTACAAAGATATAATCGAGGCAGTGGATGTGAATCTTACGGTACGAGTTCAAGCC
ATCCGCAAGCTTCCACTGTTCTGCAAAGATGCACCTGAGCTTGTATCTAAGATAATTGATGTCCTAGTACAGTGTCTAGC
CATTGATCAACAGGAGCAGCATGAAGCTGTGCATGAGACTTTTATGTCATTATTTCAGCAGGACACATTATCCGATTTGA
TCAATAAGCTTCCAGAGCCGAGGAAGCTTGATTTGCTTGAAGCTCTTGCTGAGATCTCACCACACACAACAACTCTGATA
GCATCCGAGATGCTTCCCCCAATATTTGAGCTCTTAAAGAAATACATGCCTGCCAGGAACACTGTGGAAAAATCAGACTC
CAGATATGTTGAGTGCTTATTATACGTGTTTCATCATATGGCGCACAAGGTTCCTGAAGCAACAAATAGCTTGTGCGGGT
ACAAAGTTGTGCCCACACAACCATCAGATAGAATCGGGGATGACTTTTCGAAGTTATACAAGGAATCCACTGAGAGATTG
ATCAATCTTGAGGATCTAATCAAAGCATCAGTGGAGCAACTGGTACAAGAAATGAGTGACCACGACAAAGCCTATTTGCT
TTTTGATTCTATGAGCGGTGATGATAAGGCGATATTGTATATGAAGAGGCAAGATACAAAAACTGAACTAAGAACATGCA
TAAACATACTCGCAATGACAGAGGTTTTGCATGCAGAAGTGCCTTCCTTTATCGGGGACACCAATGTTGTTAAGCTTTCT
TGGAAAGAAGCCACAAAGCCATTAGCCTATACAAGAGCTTTATATACAGACCTAATGTATGGCATACCCCCGGATATTGA
TGCGTTTCATAATTTTATGGACAAACTCTCAGAAGACTTGCTGAATAAACTAGATATGGAGGGAATGTGCGAATTAGAAG
ATGATCAGGTTCAAGCACTTGTGGGTTCATCAGGACTTAAACAAGCACAAGACACGTTACCAGAAAGTAGGATTTTCTTA
CATGAAAATCCAAAAGTACCTTGTCTCTTTTGGAGGATACGAGAATCGACATTATTAAAATTGGTGACGTCCAAGTCATG
GAAGAAATTCCTAGGTTTTATTAGAGACCAACTCTTTCACCTCATTTGTTGGGCTTATGCAGCCTCTGACTTAGTCAGTG
CTACTAGAATTATGCGCAACTGGGAGGTAGAGTATATTCCTCTGTGTCCATGGTATCTTTGCTCCTTTTGTCGACCAGAG
TATCTTGGAGAAGATGAAAATCCTGAGAAAGAAGATGATGAAAATCCTGAGAAAGGGCATTACTGTTATGGAAATGATAT
AGAGGATTGCCTACTATACATCAAACAGCATGGCATTCCTAGAGAGATCTGCAAGAAGTTTGACTGTAAGGACTGGCAGC
CTCCAAATGCTGACGACCCACATATGCACACGACAAAATTAAAGAGTGTTCGAAAAATTGAATCAATGGAGGAGGCGTTG
CTATTGCTTCCACATTTTCCCATAGGAGCGGACTTAGTTGTTTTTAAGGAATTGTGGACCGTAGGAGAGGAGATTTATTA
TGGTCCCGGAACAAATTCCAGAGGTTTCCGCTCATATCATGCAGTGATAGTATCCAGTATTGAGATCTATAAAGGAGAAG
TGGTGGCCATCTGTAAGATGAGCAATGGTACTAAAGTTTGTGACGAAGGATATGTTAGGGTTTCTCTAGCGACAACATAC
ATGGTTGTGGGTGCCAGTCCTAAAAAAAAAGAACATGTTCGGGCTACTTCTAAGCCGATGCATCTTCTCTCTGAATTCAT
CATCATAGATATAGATGAGAATGAGAAAGAGAAAGAAAGAGAGAGAGAGAAAGAAACTGAAAGCGAAGAGGAGAATCCAG
AAGATAACCAGAAAGGGAATCCAGAACATAACCCGAAAGAGAAGTCCGAAGAGATGCAATATCCTGACTTTGGTGCTAGC
AAGTTTCATAACTCCTTGAACGAGCACATCATGCCTGATTCTGACAAGAGCTTGGGCAATGTAAGTGGAGAAGAAATCAA
GATGGTTACGGAAGGTTTGACAAGTTTGAGTAAATTTGGAGAGAAAGGTCCTCAAGAAAGAATGCACGAACCTGTAGAAA
TTGTTGAAAGAGGAAAACGGCCTGCAAATGAAGCCGGTAATGATGTGGGTACAAAGAAGGCCCGTACAGAGTCATCAGGT
TGTGCACATGGGATTTGA