Details for Arabidopsis Locus AT3G19510

Position : Chr3 ( 5`- 6762764 .. 6766588 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19510

Protein [Map View]
MYKAVSKRVTRSSGSGLKQTNVDNGGEISPTVDRVSEQGKSSEAGSHMPTDANGNGHLHHEIMDHGKGNEEQKPTPQTVK
KDSNTNTKFSGSHRELVIGLPCRGQFEIHNRSRASTSSKRLGGGGERNVLFASHKRAQRSKEDAGPSSVVANSTPVGRPK
KKNKTMNKGQVREDDEYTRIKKKLRYFLNRINYEQSLIDAYSLEGWKGSSLEKIRPEKELERATKEILRRKLKIRDLFQH
LDTLCAEGSLPESLFDTDGEISSEDIFCAKCGSKDLSVDNDIILCDGFCDRGFHQYCLEPPLRKEDIPPDDEGWLCPGCD
CKDDSLDLLNDSLGTKFSVSDSWEKIFPEAAAALVGGGQNLDCDLPSDDSDDEEYDPDCLNDNENDEDGSDDNEESENED
GSSDETEFTSASDEMIESFKEGKDIMKDVMALPSDDSEDDDYDPDAPTCDDDKESSNSDCTSDTEDLETSFKGDETNQQA
EDTPLEDPGRQTSQLQGDAILESDVGLDDGPAGVSRRRNVERLDYKKLYDEEYDNVPTSSSDDDDWDKTARMGKEDSESE
DEGDTVPLKQSSNAEDHTSKKLIRKSKRADKKDTLEMPQEGPGENGGSGEIEKSSSSACKQTDPKTQRLYISFQENQYPD
KATKESLAKELQMTVKQVNNWFKHRRWSINSKPLVSEENVEKLKTGKEGECETSVAGSSKQTMETESVAEKPTNTGSRKR
RRK*

DNA
ATGTATAAAGCAGTAAGTAAGCGGGTAACTAGAAGTAGTGGATCTGGTTTGAAGCAGACAAATGTAGATAATGGAGGAGA
GATTAGTCCAACTGTTGACAGAGTATCTGAACAAGGCAAATCATCAGAGGCAGGGAGTCACATGCCAACTGATGCAAACG
GAAATGGACATTTGCATCATGAGATTATGGATCATGGAAAGGGGAATGAAGAACAGAAACCAACCCCTCAAACCGTGAAG
AAGGATTCTAATACCAATACCAAATTTTCAGGGTCTCATCGTGAGCTTGTCATCGGTCTTCCTTGCCGTGGACAATTTGA
AATCCACAACCGGTCCAGGGCATCTACGAGTTCGAAGAGGTTAGGAGGAGGTGGAGAAAGGAATGTGTTGTTTGCAAGTC
ACAAGAGAGCTCAGAGATCTAAGGAAGATGCTGGACCATCTTCGGTTGTTGCTAATTCCACACCTGTAGGTCGACCAAAG
AAAAAGAATAAGACTATGAACAAAGGACAAGTTAGAGAAGATGATGAGTACACAAGAATCAAAAAGAAACTTCGATACTT
TCTAAACCGGATTAACTATGAGCAAAGCCTAATTGACGCCTATTCGTTAGAAGGCTGGAAAGGTTCAAGCCTGGAAAAGA
TAAGGCCAGAGAAAGAGCTTGAACGAGCCACAAAGGAAATTTTGCGGCGCAAGCTTAAAATTAGAGATCTTTTTCAGCAC
CTTGACACACTCTGTGCTGAAGGAAGCCTTCCAGAGTCTTTATTTGATACTGATGGAGAGATTTCTAGCGAGGATATCTT
CTGTGCAAAATGTGGTTCAAAGGACTTGTCTGTTGATAATGATATCATACTATGCGATGGGTTTTGCGATCGAGGCTTTC
ACCAATACTGTCTTGAACCACCTCTGCGGAAAGAAGATATTCCTCCGGATGATGAGGGTTGGCTATGCCCCGGATGTGAT
TGCAAAGATGACAGCTTGGACTTGCTTAATGATTCTTTAGGGACAAAATTTTCGGTCAGCGACAGTTGGGAGAAAATATT
TCCTGAGGCAGCAGCAGCGCTGGTTGGTGGAGGTCAAAATCTTGACTGTGATCTTCCTTCAGATGATTCTGATGATGAAG
AGTATGATCCAGATTGTTTGAATGATAATGAAAATGATGAAGATGGCAGTGATGACAATGAAGAATCTGAGAACGAAGAT
GGTAGTTCTGATGAAACTGAATTCACATCTGCATCTGACGAAATGATTGAGTCATTTAAAGAAGGGAAAGATATAATGAA
AGATGTAATGGCCCTTCCATCTGATGATTCTGAGGATGATGACTATGATCCTGATGCCCCGACTTGTGATGATGATAAAG
AAAGTTCAAATTCTGATTGTACATCAGACACTGAAGATCTTGAAACTTCCTTCAAAGGAGATGAGACTAATCAGCAAGCT
GAAGATACACCACTTGAGGATCCTGGCAGACAGACGTCTCAGCTCCAAGGTGATGCAATTTTAGAGTCAGATGTTGGGCT
TGATGATGGTCCTGCCGGTGTATCCAGAAGGAGGAATGTTGAAAGGCTGGATTACAAAAAGTTGTATGATGAGGAATATG
ACAATGTTCCGACTTCGTCAAGTGATGATGACGATTGGGATAAAACTGCAAGAATGGGAAAAGAAGATTCCGAGTCGGAA
GATGAAGGGGACACTGTACCTCTGAAACAGTCTTCAAATGCAGAAGATCATACTTCTAAGAAACTTATACGGAAGTCGAA
AAGGGCAGATAAAAAGGATACCTTAGAAATGCCACAAGAAGGTCCTGGAGAAAATGGTGGTTCTGGTGAAATTGAAAAAA
GCAGCTCTTCAGCATGTAAACAGACAGATCCCAAAACTCAGAGACTGTACATATCTTTTCAAGAGAATCAATATCCAGAC
AAAGCCACGAAGGAGAGCTTAGCCAAAGAGCTACAAATGACAGTTAAGCAAGTTAATAACTGGTTTAAGCATAGGCGTTG
GTCGATAAACAGCAAACCTTTAGTTTCAGAGGAAAATGTCGAGAAGTTAAAAACAGGCAAGGAAGGTGAATGTGAGACAT
CTGTTGCTGGAAGTAGCAAACAAACTATGGAAACCGAGTCAGTTGCAGAGAAACCAACCAATACTGGATCACGGAAAAGA
AGAAGAAAGTAG