Details for Arabidopsis Locus AT3G19508

Position : Chr3 ( 5`- 6762127 .. 6762720 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19508

Protein [Map View]
MKKVLRVYGGVMRLVRLLPADSRPYYAKYARENFVNYREVDQSETSLDELFQRAYNHSLWVLKKYSIDESAATKLKEICF
E*

DNA
ATGAAGAAGGTGCTGAGAGTATACGGCGGCGTTATGAGGCTGGTGAGACTTTTGCCGGCGGATTCAAGGCCGTATTACGC
CAAGTACGCCAGGGAGAATTTCGTTAATTACCGTGAAGTCGATCAAAGCGAAACATCCCTCGACGAACTCTTCCAGCGAG
CCTATAATCACTCACTTTGGGTACTCAAGAAGTACTCAATTGACGAATCAGCAGCGACGAAGTTGAAAGAGATTTGTTTT
GAATAA