Details for Arabidopsis Locus AT3G19500

Position : Chr3 ( 5`- 6759016 .. 6760939 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19500

Protein [Map View]
MGDTAEDQDDRAMMEAEGVTSFSELLMFSDGVLSSSSDHQPEGNVGDGGEDSLGFVFSGKTGSRMLCFSGGYQNDDESLF
LEPSVPTSGVSDLDPSCIKIDCRNSNDACTVDKSTKSSTKKRTGTGNGQESDQNRKPGKKGKRNQEKSSVGIAKVRKERL
GERIAALQQLVSPYGKTDAASVLHEAMGYIKFLQDQIQVLCSPYLINHSLDGGVVTGDVMAAMKAKDLRSRGLCLVPVSS
TVHVENSNGADFWSPATMGHTTSPSLPQGF*

DNA
ATGGGAGATACCGCAGAGGATCAGGACGACCGAGCTATGATGGAAGCTGAAGGAGTAACGAGCTTCTCCGAACTTCTTAT
GTTCTCTGACGGCGTTCTCAGCTCCTCTTCCGACCACCAACCTGAGGGTAATGTCGGCGATGGTGGAGAAGACAGTTTAG
GTTTTGTATTCTCCGGCAAAACTGGCTCAAGAATGCTCTGTTTTAGTGGAGGCTATCAAAACGACGACGAGTCACTCTTC
CTAGAACCTTCTGTTCCAACCTCCGGAGTCTCTGATCTTGACCCTTCATGCATTAAGATTGATTGCAGGAACTCAAACGA
CGCGTGTACGGTCGATAAATCTACTAAATCATCAACCAAGAAGAGAACCGGAACGGGTAATGGGCAAGAGTCGGATCAAA
ATCGAAAACCGGGCAAGAAAGGGAAACGAAATCAAGAGAAATCATCAGTTGGAATTGCAAAGGTCAGGAAAGAAAGGTTA
GGGGAAAGAATTGCAGCGTTGCAGCAGTTGGTTTCTCCATACGGCAAGACAGATGCAGCTTCTGTGTTGCATGAAGCGAT
GGGTTACATCAAATTCTTACAAGATCAGATTCAAGTCCTTTGCTCTCCTTATCTAATCAACCATTCTCTCGACGGTGGAG
TTGTCACCGGAGATGTAATGGCGGCGATGAAAGCGAAAGACTTGAGAAGCAGAGGATTATGTCTAGTACCTGTCTCATCC
ACCGTACACGTGGAAAATTCCAACGGTGCTGATTTCTGGTCACCTGCTACTATGGGTCACACTACGTCACCGTCGTTACC
TCAAGGATTTTAA