Details for Arabidopsis Locus AT3G19490

Position : Chr3 ( 5`- 6754615 .. 6758261 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19490

Protein [Map View]
MAVFPIGSHFAPPHQLTKRHVIATSSPISISTRLPQNVSFSKVSGVTGSTRLSKHGVLVRAEDKIRSSSSPSSLDEPIDE
DLMDSSGLCDPLCSVDEPSSSYFEANYQPKTDIIKALAILAAALTGTAAINHSWVAANQDVAMALLFGIGYAGIIFEESL
AFNKSGIGLLMAVSLWVVRSIGAPSTEIAVLDLQHATAEVSEIVFFLLGAMTIVEIVDAHQGFKLVTDNITTRKPKTLLW
VVGFVTFFLSSILDNLTSTIVMVSLIRKLVPQSEYRKLLGGVVVIAANAGGAWTPIGDVTTTMLWIHGQISTLPTMKDLF
LPSVVSLAVPLALMSLTSEVNGKEQDPKDVLASEKMAPRGKLVFGVGLGALVFVPVFKALTGLPPYMGILLGLGVLWILT
DAIHYGESERQKLKVPQALSRIDTQGALFFLGILLSVSSLEAAGILREIANYLDANIPNVELIASAIGVVSAIIDNVPLV
AATMGMYDLTSFPQDSEFWQLIAFCAGTGGSMLVIGSAAGVAFMGMEKVDFFWYFRKVSGFAFAGYAAGIAAYLAVHNLH
FEIPTTVAQIPFLTGS*

DNA
ATGGCGGTGTTTCCTATCGGTTCTCACTTTGCACCGCCGCATCAGTTGACGAAGAGACACGTCATCGCGACTTCATCACC
TATCTCCATCTCCACCCGATTGCCGCAAAATGTTTCCTTTTCGAAAGTATCTGGAGTTACAGGCTCGACGAGGTTATCCA
AACATGGTGTTCTCGTGAGGGCCGAGGATAAGATAAGGAGCTCTTCTTCTCCTTCTTCTCTCGATGAACCAATCGATGAG
GATTTGATGGACTCATCAGGATTATGTGACCCGTTATGCTCGGTTGATGAACCTAGTTCAAGTTACTTTGAGGCGAATTA
TCAGCCAAAGACAGATATAATCAAAGCTCTTGCTATTCTTGCAGCAGCTCTTACAGGAACAGCTGCCATTAACCATTCCT
GGGTCGCTGCTAATCAGGATGTTGCTATGGCATTGTTGTTTGGAATAGGATACGCTGGCATCATCTTTGAAGAGTCTTTA
GCTTTTAATAAAAGTGGAATAGGACTTTTGATGGCTGTGAGTTTGTGGGTTGTGCGGAGCATAGGGGCTCCTTCAACTGA
AATAGCTGTTTTAGATCTTCAACATGCAACAGCTGAAGTTAGTGAAATAGTATTTTTCTTGCTTGGCGCAATGACCATTG
TGGAGATAGTTGATGCTCACCAAGGGTTTAAGTTGGTTACAGACAATATCACCACTCGGAAGCCAAAGACACTTTTATGG
GTGGTTGGCTTTGTGACTTTCTTTCTCAGTTCGATTCTAGACAATCTGACCTCTACCATTGTCATGGTTTCTTTAATAAG
GAAACTGGTTCCACAATCAGAGTACCGCAAACTTCTAGGAGGTGTGGTAGTGATAGCAGCAAATGCAGGAGGAGCATGGA
CTCCAATTGGTGATGTTACTACAACTATGTTATGGATTCATGGTCAGATATCCACCTTGCCGACTATGAAGGACCTTTTT
CTACCTTCGGTTGTGTCTCTTGCTGTTCCACTAGCCCTCATGTCTTTGACCAGTGAGGTAAATGGAAAGGAACAGGATCC
TAAAGATGTATTGGCTTCTGAAAAGATGGCTCCAAGAGGGAAGCTAGTTTTTGGAGTTGGCCTTGGAGCATTGGTTTTTG
TTCCAGTCTTTAAAGCTCTAACTGGATTGCCTCCTTACATGGGTATCTTGTTGGGTCTTGGAGTTCTTTGGATCTTGACA
GATGCCATTCATTACGGTGAATCAGAAAGACAAAAGCTCAAAGTACCTCAAGCCTTATCTCGAATAGACACACAAGGTGC
TCTGTTTTTCCTCGGGATTCTTTTATCCGTAAGCAGCCTTGAGGCAGCTGGGATACTCCGGGAGATTGCAAACTACCTTG
ATGCCAATATACCCAACGTTGAGCTCATTGCAAGTGCTATCGGTGTTGTATCAGCAATCATAGACAATGTTCCACTGGTT
GCAGCGACTATGGGGATGTATGATCTCACATCGTTCCCTCAAGATTCTGAATTTTGGCAGCTCATTGCATTCTGTGCCGG
CACTGGTGGTTCGATGCTTGTCATTGGTTCTGCTGCTGGTGTAGCCTTCATGGGGATGGAGAAAGTCGATTTCTTTTGGT
ATTTCCGAAAGGTTAGTGGTTTTGCTTTTGCTGGCTATGCTGCTGGTATCGCAGCTTATCTGGCCGTTCATAATCTTCAT
TTCGAGATCCCAACAACTGTGGCTCAGATCCCATTTCTCACTGGTTCATAG