Details for Arabidopsis Locus AT3G19480

Position : Chr3 ( 5`- 6752531 .. 6754785 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19480

Protein [Map View]
MATSLNLSSIFSSSSRLVTTPSSVFPIRQRRRIILVTSSSSGGGGKPTILVTEKLGQAGIDLLKKYANVDCSYDLSLEEL
CTKISLCDALIVRSGTKVGRDVFESSRGRLKVVGRAGVGIDNVDLAAATEYGCLVVNAPTANTVAAAEHGIALLTAMARN
IAQADASIKAGKWTRNKYVGVSLVGKTLAVLGFGKVGSEVARRARGLGMHVITHDPYAPADRARAIGVELVSFEVAISTA
DFISLHLPLTAATSKMMNDVTFAMMKKGVRIVNVARGGVIDEEALLRALDSGIVAQAALDVFTVEPPVKDNKLVLHESVT
ATPHLGASTMEAQEGVSIEVAEAVIGALRGELAATAVNAPMVPLEVLRELKPYVVLAEKLGRLAVQLVTGGSGVNAVKVT
YASSRAPDDLDTRLLRAMVIKGIIEPISSVFINLVNSDYIAKQRGVKISEERMVLDGSPENPIEYITVRIANVESRFASA
LSESGEIKVEGRVKQGVPSLTKVGLFGVDVSLEGSVILCRQVDQPGMIGKVASILGDENVNVSFMSVGRIAPGKQAVMAI
GVDEQPSKETLKKIGDIPAIEEFVFLKL*

DNA
ATGGCGACGTCTCTGAATCTATCATCGATCTTCTCCTCCTCCTCAAGGCTCGTCACCACTCCCTCCTCTGTTTTTCCCAT
CCGTCAGAGGCGACGGATCATCCTCGTTACGTCTTCTTCTTCCGGAGGTGGAGGAAAACCGACGATTCTCGTAACGGAGA
AGCTAGGCCAAGCGGGGATCGATCTGCTTAAGAAGTACGCTAATGTGGATTGCTCTTATGATCTGAGTCTCGAGGAGCTT
TGTACGAAGATCTCTCTTTGTGATGCGCTCATCGTCAGGAGTGGTACCAAGGTTGGGAGAGATGTGTTTGAATCGTCGCG
TGGGAGGCTTAAGGTTGTTGGACGCGCTGGTGTTGGGATTGATAACGTCGATTTGGCGGCGGCGACTGAGTATGGGTGTT
TGGTTGTTAATGCTCCGACTGCGAACACTGTGGCTGCTGCTGAACACGGAATTGCGCTTTTGACCGCCATGGCTAGAAAC
ATTGCTCAAGCTGATGCTTCTATCAAAGCTGGCAAATGGACGAGAAACAAGTATGTAGGTGTTTCACTTGTGGGGAAGAC
TCTTGCTGTTCTTGGTTTTGGTAAAGTTGGATCAGAGGTTGCTAGACGAGCCAGGGGACTTGGTATGCATGTCATTACAC
ATGATCCTTATGCACCAGCGGATCGTGCACGAGCTATTGGTGTGGAGCTTGTTAGTTTTGAAGTAGCTATTTCAACTGCT
GACTTCATCTCTTTGCATCTGCCTCTTACTGCTGCTACTTCGAAGATGATGAATGATGTGACCTTTGCGATGATGAAGAA
AGGAGTCCGTATTGTTAATGTTGCTCGTGGTGGAGTTATTGATGAGGAAGCTCTTTTGAGAGCGCTTGACTCGGGTATTG
TTGCTCAGGCAGCTCTTGATGTTTTTACAGTAGAGCCACCTGTTAAAGATAATAAGTTGGTGTTACATGAGAGTGTCACT
GCCACACCTCATCTTGGTGCTAGTACTATGGAGGCTCAGGAAGGAGTGTCTATCGAAGTCGCAGAAGCTGTTATTGGAGC
TTTGAGAGGAGAACTTGCTGCTACCGCGGTCAATGCACCAATGGTTCCACTAGAGGTATTGAGGGAGCTGAAGCCGTATG
TTGTACTTGCTGAGAAGCTTGGGAGGCTGGCTGTACAATTGGTAACTGGTGGAAGCGGTGTGAATGCTGTGAAAGTGACT
TATGCTTCTTCCAGAGCTCCTGATGATCTCGACACTAGACTTCTCCGAGCCATGGTCATAAAGGGGATCATCGAACCCAT
TTCCAGCGTATTCATAAATCTGGTTAACTCCGATTATATTGCCAAACAACGTGGAGTCAAAATCTCAGAAGAACGTATGG
TTCTAGACGGCTCACCTGAGAATCCAATTGAATACATAACTGTTCGGATAGCAAACGTGGAATCAAGATTTGCCAGCGCT
TTATCAGAGTCCGGTGAGATCAAAGTAGAAGGCAGAGTGAAACAAGGGGTTCCAAGTCTTACCAAAGTCGGATTATTTGG
AGTGGATGTGAGTTTAGAAGGGAGTGTGATTCTGTGCAGGCAAGTAGATCAGCCTGGGATGATCGGTAAAGTTGCTAGCA
TCTTAGGAGATGAAAACGTCAACGTGAGCTTCATGAGCGTCGGTCGAATCGCTCCAGGCAAGCAAGCTGTGATGGCAATT
GGAGTAGATGAACAACCAAGCAAAGAAACTTTGAAGAAAATCGGAGACATTCCTGCCATTGAAGAGTTTGTTTTCCTCAA
ACTATAG