Details for Arabidopsis Locus AT3G19460

Position : Chr3 ( 5`- 6747370 .. 6749307 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19460

Protein [Map View]
MQFFAVADLLLWRNRTGAVILLISSTGFWFLFERAGYNLLSFVSNVLLLLVAIFFLWAKSATVLNRPLPPVPNMEIPEEF
ANKAADDLRVWINYVLSIASDITIARNPIRLLQVFFHHLWQTICCIFLFLHVMYLTVHISFVFAVKQVSLVLWAISYVGT
LINSLTLVYIGVLLSLSFPIVYEKYQDHIDEKVNSTSKFVRNISRKFPLPINKEKKHQ*

DNA
ATGCAATTTTTTGCAGTTGCTGATTTGCTGCTATGGAGAAACCGGACTGGTGCAGTCATTTTGCTAATCTCTTCTACTGG
GTTTTGGTTCTTATTCGAGAGAGCTGGATACAATCTCTTGTCTTTCGTCTCCAATGTTCTGCTTCTTCTCGTTGCGATCT
TCTTCTTATGGGCCAAGTCTGCTACAGTTCTCAACCGACCGCTACCTCCAGTTCCGAATATGGAAATCCCTGAGGAGTTT
GCAAATAAGGCTGCTGATGATCTTCGGGTTTGGATCAATTATGTACTGTCAATTGCAAGTGATATCACCATAGCTAGAAA
TCCGATTCGTCTCCTTCAGGTTTTCTTTCATCACTTGTGGCAAACCATTTGTTGTATCTTTTTGTTTCTGCATGTGATGT
ATCTCACTGTTCACATCTCGTTTGTTTTTGCTGTGAAACAGGTTTCTCTTGTCTTGTGGGCTATATCCTATGTTGGGACT
TTAATCAACTCCCTCACTCTTGTTTACATTGGAGTTCTTCTCAGTCTTTCTTTTCCTATTGTGTATGAGAAGTACCAAGA
CCACATTGATGAGAAAGTGAACTCGACTTCTAAATTCGTTCGAAATATCTCAAGGAAGTTTCCATTGCCCATAAACAAAG
AGAAGAAACATCAGTAG