Details for Arabidopsis Locus AT3G19420

Position : Chr3 ( 5`- 6731376 .. 6735623 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19420

Protein [Map View]
MSSESPNLPAAAGTVPDNHPPPPPVVTAAEAGSDDSPKGVASKLSAAGISNWAKNLKVPQPFASTQNDSGVENTEKSAFA
KFTSGLGIRLSPKSPQTNDTTTEGTSSATESSFIGTITKGLVDTSKNAVKAVQVKARHAVSQNKRRYQEGGFDLDLTYIT
ENIIAMGFPAGDMSSGFFGYVEGFYRNQMEEVINFLETQHKGKYKVYNLCSERLYDVSLFEGKVASFPFDDHNCPPIHLV
TSFCQSAYSWLKEDIENVVVVHCKAGMARTGLMICSLLLYLKFFPTAEECMDFYNQKRCVDGKGLVLPSQIRYVKYFERI
LTYFNGENQPGRRCMLRGFRLHRCPYWIRPSITISDHNGVLFTTKKHPRTKDLSPEDFWFSAPKKGVMVFALPGEPGLTE
LAGDFKIQFHDRQGDFYCWLNTTMMENRVILKTSELDGFDKRKLPSPGFMVEVVLADINATIPTNPSSETASKTPEETSA
ANSSPVDGSASVPGPDKETENPDKDDVFSDNEGDSTGPTKTTSSASSQTPEAKKSADETAVLTKATEKVSISGNKGSSQP
VQGVTVSKGEATEKPSGAGVNASSSSESEFKVMAADASVFSFGDEDDFESD*

DNA
ATGTCGTCTGAGTCACCGAATTTGCCTGCTGCTGCGGGAACAGTACCAGATAATCATCCTCCTCCTCCTCCTGTTGTTAC
TGCTGCAGAAGCTGGAAGCGATGATTCACCTAAAGGAGTAGCATCAAAACTATCTGCTGCTGGGATTTCAAATTGGGCCA
AAAACTTGAAAGTTCCACAGCCTTTTGCTTCCACACAAAACGACTCTGGTGTCGAAAACACCGAGAAGTCTGCGTTTGCA
AAGTTTACAAGCGGGTTAGGGATTCGTTTATCTCCGAAATCTCCTCAAACGAATGACACTACCACAGAAGGAACTTCGAG
TGCTACAGAATCTAGTTTTATTGGGACTATTACGAAAGGTTTGGTAGATACATCAAAGAATGCTGTCAAGGCAGTACAAG
TCAAGGCTCGACATGCTGTATCACAGAACAAACGAAGATATCAGGAAGGAGGATTTGATTTGGATTTGACGTACATAACA
GAGAACATCATTGCAATGGGGTTTCCTGCTGGTGATATGAGTTCTGGCTTTTTTGGATATGTTGAGGGTTTCTACCGTAA
CCAAATGGAAGAAGTTATTAACTTTCTTGAAACTCAACACAAGGGAAAATACAAGGTTTACAATCTTTGTTCAGAGAGAT
TGTATGATGTATCATTATTTGAAGGGAAGGTGGCCAGTTTCCCATTTGATGATCATAATTGCCCGCCAATCCATTTGGTC
ACCTCATTCTGCCAAAGTGCATATTCATGGTTAAAGGAGGACATTGAGAACGTTGTGGTTGTTCACTGTAAGGCTGGCAT
GGCAAGGACAGGGCTTATGATATGCAGTCTTCTGTTGTATCTGAAGTTCTTTCCCACTGCCGAAGAGTGTATGGACTTCT
ACAACCAGAAACGATGTGTGGATGGAAAAGGACTTGTGCTACCCAGCCAAATTAGATATGTGAAATACTTTGAAAGAATT
TTGACCTACTTCAACGGTGAAAACCAACCAGGCCGTAGGTGTATGCTTAGGGGATTCCGGCTCCATAGGTGTCCCTATTG
GATTAGGCCATCCATCACTATTTCAGATCACAATGGTGTTCTCTTTACCACGAAAAAGCATCCTCGGACCAAGGATCTCT
CGCCTGAAGACTTTTGGTTCAGTGCCCCAAAGAAAGGGGTTATGGTCTTTGCCTTACCTGGAGAGCCAGGTCTAACAGAA
TTGGCTGGGGACTTCAAAATCCAATTTCATGACCGGCAAGGAGATTTCTACTGCTGGTTAAACACGACAATGATGGAAAA
TAGAGTGATCCTAAAAACCAGTGAGCTTGATGGGTTTGACAAGAGGAAGCTACCATCGCCTGGATTTATGGTTGAAGTTG
TTCTAGCTGATATAAATGCAACAATCCCTACGAACCCTAGTTCTGAAACAGCATCCAAAACACCGGAAGAAACTTCAGCA
GCTAATTCGTCCCCTGTAGACGGCTCTGCATCGGTTCCAGGACCCGATAAAGAAACAGAGAATCCTGATAAGGACGATGT
GTTCTCTGATAACGAAGGAGACTCAACTGGCCCGACCAAAACCACATCATCGGCTTCTTCTCAAACCCCAGAAGCCAAAA
AGAGCGCAGATGAAACCGCTGTTCTGACTAAAGCGACAGAGAAAGTGTCTATTTCTGGAAACAAAGGATCATCACAGCCG
GTGCAAGGAGTAACTGTGAGCAAGGGTGAAGCAACAGAAAAACCCTCTGGGGCTGGGGTCAATGCTTCTTCAAGCTCAGA
GAGTGAGTTCAAGGTTATGGCGGCTGATGCATCTGTGTTCTCATTTGGAGATGAAGACGACTTTGAAAGCGATTGA