Details for Arabidopsis Locus AT3G19380

Position : Chr3 ( 5`- 6714392 .. 6716099 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19380

Protein [Map View]
MPRNIEPLDLGIQIPYHFRCPISLELMQDPVTVCTGQTYDRASIESWVSIGNNTTCPVTRAPLSDFTLIPNHTLRRLIQE
WCVANRSNGVERIPTPKQPADPTSVRALLSQASAITGTHVSVRSRAAALRRLRGFARDSDKNRVLIAAHNATEILIKILF
SETTSSELVSESLALLVMLPITEPNQFVSISSDPGRVEFLTRLLFDSSIETRVNAAALIEIVSTGTKSADLKGSISNSES
VFEGVLDLLRNPISSRRALKIGIKTLFALCSVKSTRHIAITAGAPEILIDRLAADFDRCDTERALATVELLCRTPEGCAA
FGEHALTVPLLVKTILRVSDRATEYAAGALLALCTAEERWREEAAGAGVVVQLLLMVQSECTERAKKKAQKLLKLLRDSW
PDYNSFANSDDFGCSSQVVPF*

DNA
ATGCCTAGGAATATAGAACCATTGGATCTTGGAATCCAAATACCATATCATTTCAGATGTCCAATATCACTCGAACTTAT
GCAAGACCCAGTCACCGTCTGCACCGGCCAAACCTACGACCGAGCCAGCATCGAGTCATGGGTCTCCATCGGTAACAACA
CGACATGTCCAGTCACACGAGCTCCTCTCTCCGACTTCACACTCATCCCTAACCACACTCTCCGTCGTCTCATCCAAGAA
TGGTGCGTCGCTAACCGCTCCAATGGAGTCGAACGTATCCCTACTCCTAAACAACCAGCTGATCCAACCTCTGTTCGTGC
TCTTCTCAGTCAAGCCTCTGCTATAACAGGAACCCACGTCTCTGTTCGTTCACGCGCCGCCGCTCTCCGCCGTTTACGTG
GTTTCGCTCGTGATTCTGATAAAAATCGCGTTTTGATCGCAGCTCATAACGCTACAGAGATTTTGATTAAGATTCTGTTC
TCTGAAACGACGTCGTCGGAGTTAGTCTCTGAGTCTTTAGCTCTACTTGTTATGTTACCGATAACGGAGCCGAACCAGTT
TGTTTCGATATCGTCGGATCCGGGTCGGGTCGAGTTTTTGACCCGGTTGTTATTCGATTCGTCGATTGAAACACGCGTTA
ACGCCGCCGCGTTGATCGAGATTGTTTCGACGGGAACCAAATCGGCGGACCTGAAAGGTTCGATTTCGAATTCAGAATCT
GTATTCGAAGGAGTTCTCGATCTTCTGAGAAATCCGATTTCGTCACGACGAGCTCTCAAAATCGGAATCAAAACTCTGTT
CGCGCTCTGTTCAGTGAAATCGACGCGACACATCGCGATCACAGCCGGTGCGCCGGAGATTCTAATAGACAGACTCGCGG
CGGATTTCGATAGATGCGATACGGAGCGAGCCTTAGCGACGGTGGAGCTACTCTGCCGAACGCCGGAAGGATGCGCGGCG
TTCGGTGAGCACGCTTTAACGGTGCCGTTGTTAGTTAAAACGATATTGAGAGTTTCGGATCGCGCGACGGAGTATGCGGC
GGGGGCGTTGTTAGCGCTTTGTACGGCGGAGGAAAGGTGGAGGGAGGAAGCGGCGGGGGCGGGAGTGGTGGTACAGTTGT
TGTTGATGGTGCAGAGTGAGTGTACGGAGAGAGCGAAGAAGAAAGCACAGAAGTTATTGAAGCTTCTGAGAGATTCATGG
CCTGACTACAATTCCTTCGCTAACTCCGATGACTTTGGTTGCAGCAGCCAAGTGGTCCCTTTTTGA