Details for Arabidopsis Locus AT3G19370

Position : Chr3 ( 5`- 6710720 .. 6713650 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19370

Protein [Map View]
METNQWRSRKKIESAAETLQVSSRRGRGQARMVPPVSGVRSERARKSLSEKLETVALNSPKKDARVSLYGEKSVVDEIFL
EDEEMGHETGLKNGESSPFCGVSDKLLQRIELLGRDHEATRLDNNKFRSIESMKKRQEESACDDLVDMKTKIQTLAAENT
QLKKSLVAKEELAVSLQERKFQVESEFEALMTRLDSTEKENAFLRYEYTVLEKDLQVKTEETEHTRRSMELTHKQQLRNV
NKIVELEAECQRLRLLFRKKFPEKSISMRNEGEEKKMEMRRRNANKSDMMMRDEVQSRKLKYDLLMEQIGNVRAENKNLM
DIIMKKNIEIKDLSRGQKPLEASSFDIQSESSVMSPCGSKEMKLLMDDFNEMEKLAIVCTEKDPRVDDEKEGSFDWIQVV
LSAITKQERISKRGVKELLQDIKIALGCMDENDNVERKKGEEDPLCITWKSNNESGPMTKDEIKRHLGLTKSDKVEKIES
DEKQELRKKLEESVEKIRNLEAEMKTLRENKEKVEAEMETEKSMKEDLDTKLNITRANLNETQKKLSSLEVEFDYRKSCC
EELEGTCIELQLQLESVETKKPTQRNKNGWDIATASVKLSECQETITSLRKQLRALSTTETSSTIKFLHKRSSLRENIAE
DDTNRVAQDDDGNRYNALIVYEPVKARGEKMEMVPRKKQGLGFLKKLLFRRKRVSSKKCLALTM*

DNA
ATGGAAACAAACCAGTGGCGGTCGAGGAAAAAGATAGAATCAGCTGCAGAAACACTCCAAGTTTCTTCTAGAAGAGGCAG
AGGACAGGCACGTATGGTTCCTCCTGTAAGTGGAGTTAGATCCGAGAGAGCTCGAAAAAGTCTAAGTGAGAAGCTAGAGA
CTGTAGCTTTAAACTCTCCTAAGAAAGATGCTCGTGTGAGTCTTTATGGCGAGAAAAGTGTAGTAGATGAGATTTTCCTA
GAAGATGAAGAAATGGGTCATGAAACTGGTTTGAAGAATGGAGAGTCGTCGCCTTTTTGTGGTGTATCGGACAAGCTTCT
GCAGCGAATCGAGCTTCTTGGGAGAGACCATGAGGCAACGAGACTTGATAACAACAAGTTCAGGTCAATCGAATCTATGA
AAAAGAGACAAGAAGAATCGGCATGTGATGATCTAGTTGATATGAAGACAAAGATTCAAACGTTAGCTGCGGAGAACACT
CAGCTTAAGAAGTCTCTTGTGGCGAAAGAAGAGCTTGCGGTAAGTCTTCAAGAGCGTAAATTTCAGGTGGAATCAGAATT
CGAAGCGTTAATGACTAGATTAGATTCAACGGAGAAAGAAAACGCATTCTTGAGATATGAGTATACTGTTCTTGAGAAAG
ATCTTCAGGTAAAAACAGAGGAAACAGAGCATACTCGCAGGTCTATGGAGCTAACGCATAAGCAGCAACTTAGGAATGTG
AACAAGATTGTTGAGCTTGAAGCTGAATGCCAAAGGTTAAGACTTCTCTTTCGAAAGAAGTTTCCAGAGAAGTCTATATC
TATGAGGAATGAAGGTGAAGAAAAGAAGATGGAGATGAGAAGACGAAACGCTAATAAGAGCGATATGATGATGAGAGATG
AAGTTCAGAGCAGGAAGCTGAAGTATGATCTTTTGATGGAGCAGATTGGGAATGTTAGGGCAGAGAACAAGAATCTAATG
GACATAATTATGAAGAAAAACATTGAGATCAAAGATCTTAGCCGCGGGCAGAAACCGTTAGAGGCTTCGAGTTTCGATAT
TCAAAGCGAAAGTAGTGTGATGAGCCCCTGTGGTTCCAAGGAGATGAAGTTACTGATGGATGATTTTAATGAGATGGAGA
AGTTAGCCATTGTGTGTACTGAGAAAGATCCAAGAGTGGATGATGAGAAGGAAGGATCTTTTGATTGGATTCAAGTTGTT
TTGAGCGCTATAACGAAGCAAGAGAGGATATCGAAACGCGGTGTTAAAGAACTCTTACAAGACATTAAGATTGCTTTAGG
ATGTATGGATGAAAATGATAATGTAGAAAGAAAGAAAGGTGAAGAAGATCCTCTCTGCATCACATGGAAATCTAATAACG
AATCGGGTCCAATGACTAAGGATGAGATCAAGAGACATTTGGGTTTGACGAAATCAGATAAGGTGGAGAAGATTGAATCT
GATGAAAAGCAAGAACTGAGAAAGAAGCTTGAGGAATCAGTGGAGAAGATCAGAAACTTAGAAGCAGAGATGAAAACATT
GAGAGAGAATAAGGAAAAGGTAGAGGCAGAGATGGAAACGGAGAAATCGATGAAGGAAGATCTTGATACAAAGCTGAACA
TAACAAGAGCTAACCTCAACGAGACACAGAAGAAGTTGTCTTCTCTTGAAGTAGAATTTGATTACAGAAAGAGCTGTTGT
GAAGAACTCGAAGGGACTTGCATCGAGCTTCAGCTTCAGCTAGAAAGTGTTGAAACAAAGAAACCGACGCAGAGAAACAA
AAACGGGTGGGATATAGCAACAGCTTCTGTGAAGTTATCAGAGTGTCAAGAAACGATTACCAGTTTACGGAAGCAACTAA
GAGCGTTATCTACAACAGAAACAAGCAGCACCATTAAATTTCTACACAAAAGATCTTCTCTCCGGGAAAATATAGCAGAG
GATGATACTAACAGAGTTGCTCAAGATGATGATGGTAACCGTTACAACGCTTTGATCGTGTACGAACCAGTGAAGGCGAG
AGGTGAGAAGATGGAGATGGTACCGAGAAAGAAGCAAGGATTAGGGTTCTTGAAAAAACTGTTGTTCAGGAGGAAAAGAG
TGAGCAGCAAGAAATGTCTTGCCTTGACTATGTGA