Details for Arabidopsis Locus AT3G19360

Position : Chr3 ( 5`- 6707241 .. 6709028 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19360

Protein [Map View]
MDSSYSDSRPMFVQSPYGGWNQTQMIDSMANPMNNEQGDLHSLSESQSQSQPSQQLQPALKRPRLVDDNLFNPASSFPQP
SSSNPWMVPSLNPPPVNKGTANIFYKTRMCAKFRAGTCRNGELCNFAHGIEDLRQPPSNWQEIVGPPPAGQDRERERERE
RERERPSLAPVVNNNWEDDQKIILRMKLCRKFCFGEECPYGDRCNFIHEDLSKFREDSGKLRESSVISVGATAADQPSDT
ASNLIEVNRQGSIPVPAPMNNGGVVKTVYWKTRLCMKFDITGQCPFGDKCHFAHGQAELHNSVGRVEGEAMNAVASVNKQ
AVVPANEAFAMKPITQVTADSSGLNEEGRRKKCLLKWSDSKKINRIYGDWIDDLPVGQKSTKPVES*

DNA
ATGGATTCGAGTTACTCTGATTCTCGTCCCATGTTCGTGCAATCACCTTATGGTGGTTGGAATCAAACACAGATGATTGA
TTCAATGGCTAATCCAATGAACAATGAACAAGGAGACTTGCATTCACTATCTGAATCACAATCACAATCTCAACCGTCTC
AGCAATTACAGCCTGCATTGAAAAGGCCTAGACTTGTTGATGATAACTTGTTTAATCCTGCTTCGTCGTTTCCTCAGCCT
TCGAGTAGCAATCCTTGGATGGTTCCATCTTTGAACCCTCCTCCTGTGAACAAAGGGACTGCTAATATATTCTATAAGAC
TAGAATGTGTGCTAAATTCAGGGCAGGGACTTGTAGGAATGGTGAACTCTGTAATTTTGCTCATGGGATTGAGGATTTGA
GGCAGCCTCCGTCGAATTGGCAGGAAATTGTTGGACCTCCTCCTGCTGGTCAAGACAGGGAGAGGGAGAGAGAGAGGGAA
AGGGAGAGGGAAAGACCGTCTTTGGCGCCTGTTGTGAATAATAATTGGGAAGATGATCAGAAGATAATCTTGAGGATGAA
GCTTTGTAGGAAGTTTTGTTTTGGGGAAGAGTGTCCTTATGGGGACAGGTGCAATTTTATTCATGAGGATCTGTCAAAGT
TTCGTGAGGACTCGGGGAAGTTGAGAGAGAGCTCGGTTATAAGTGTTGGTGCTACTGCTGCTGATCAACCATCTGATACT
GCTTCTAATCTTATTGAAGTAAATAGACAAGGAAGCATCCCGGTACCTGCACCTATGAACAATGGTGGTGTTGTCAAGAC
TGTGTACTGGAAGACGAGGTTGTGCATGAAGTTTGACATCACGGGTCAATGTCCTTTTGGCGATAAGTGTCACTTTGCTC
ATGGCCAAGCAGAGTTGCATAACTCTGTTGGAAGGGTAGAAGGAGAAGCTATGAACGCGGTAGCGTCTGTGAATAAACAA
GCAGTGGTACCTGCGAATGAAGCATTTGCAATGAAACCGATTACACAAGTAACAGCAGATTCCTCTGGTCTGAATGAAGA
AGGGCGGCGAAAGAAGTGTTTGCTCAAGTGGAGCGACTCCAAGAAGATTAACCGAATATATGGAGACTGGATCGATGATT
TACCGGTGGGTCAAAAGTCGACAAAGCCAGTAGAGAGTTGA