Details for Arabidopsis Locus AT3G19350

Position : Chr3 ( 5`- 6705493 .. 6706127 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19350

Protein [Map View]
MNRLCFFNKVVKVARGDSPPFDLASLPPKEQRDLIGETLFFMVEELEPQFAPKITGMILELDQDKVLHLLVTPKAFKEMV
KEAMEVLAHSFLQQMKIARGKRC*

DNA
ATGAATCGTTTATGCTTTTTTAACAAAGTTGTAAAAGTTGCCCGTGGTGATTCACCTCCTTTTGATCTTGCTTCTTTACC
TCCCAAAGAACAACGAGATTTGATTGGTGAAACTTTGTTCTTTATGGTGGAAGAACTTGAGCCACAGTTTGCACCAAAAA
TCACAGGAATGATTCTTGAATTGGACCAAGACAAGGTCCTTCATCTGCTGGTAACACCTAAAGCCTTCAAAGAAATGGTC
AAAGAGGCAATGGAGGTCCTAGCGCACTCCTTTCTGCAACAGATGAAAATTGCTAGGGGAAAAAGATGTTAG