Details for Arabidopsis Locus AT3G19340

Position : Chr3 ( 5`- 6701273 .. 6704226 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19340

Protein [Map View]
MAEQHNKEVIRLEPESVIPILKPKLIMTLANLIEHSNDRQEFLKLCKRIEYTVRAWYLLQFEDLMQLYSLFDPVHGAQKI
QQQNLTSQEIDVLEQNFLAYLFQVMEKSNFKITSNEEMEVAHSGQYLLNLPIKVDESKLDKKLLKRYFEEHPHENIPDFS
DKYVIFRRGIGLDKTTDYFFMEKLDVIISRFWSFLMRITRLEKLRAKRSSSLNKKDPKKDDEPNPDTDNDELYVERIRLE
NSKLSFKSFLSKLTIQEPTFDRMIVVYRRASSKTNLERGIYVKHFKNIPMADMEIVLPEKRNPGLTPMDWVKFLISAVVG
LVAVLTSVEMPKSDPWVIIAILSTVLGYCAKTYFTFQQNMATYQNLITQSMYDKQLDSGRGTLLHLCDDVIQQEVKEVMI
CFYILMEQGKATLEDLDLRCEELIKEEFGARCNFDVEDAVQKLEKLGIVARDTIGRYYCMGLKRANEIIGTTTEELVLKA
KQGVTPS*

DNA
ATGGCGGAACAACACAATAAGGAAGTGATTCGTCTTGAGCCCGAATCGGTCATCCCTATCCTCAAACCTAAACTCATCAT
GACCTTGGCTAATCTCATTGAACATAGCAATGATAGACAAGAGTTCCTTAAGCTATGTAAGAGAATTGAGTACACTGTTC
GAGCTTGGTATCTTCTTCAATTTGAAGATCTCATGCAACTATACTCTCTGTTTGATCCTGTACACGGTGCTCAGAAAATC
CAGCAGCAGAACTTAACTTCTCAAGAGATTGATGTCCTTGAACAAAATTTCCTAGCTTACTTGTTTCAGGTTATGGAGAA
GAGCAACTTTAAAATAACAAGTAATGAAGAGATGGAAGTTGCACACTCTGGGCAGTATCTTCTCAATCTTCCCATCAAAG
TTGATGAGTCTAAGCTTGACAAGAAGCTGCTCAAGAGGTATTTTGAGGAGCATCCACATGAAAATATTCCAGATTTTTCT
GATAAGTATGTCATCTTCAGACGTGGTATTGGATTGGATAAAACCACAGATTATTTTTTCATGGAGAAATTGGATGTGAT
CATTTCACGTTTTTGGTCCTTTCTCATGAGAATCACCAGGTTAGAGAAATTACGCGCCAAAAGGTCAAGCAGTCTTAACA
AGAAAGATCCCAAAAAAGATGATGAGCCAAACCCTGACACAGATAATGATGAATTGTATGTGGAGCGTATTCGCCTTGAG
AATTCAAAGCTGAGCTTTAAGAGTTTTTTGAGCAAGCTCACAATACAGGAGCCTACATTCGATAGAATGATTGTTGTTTA
TAGACGAGCTAGCTCTAAAACAAATCTAGAACGAGGAATCTACGTTAAGCATTTCAAAAACATTCCTATGGCTGACATGG
AGATTGTGCTTCCTGAGAAAAGAAACCCTGGACTGACTCCAATGGATTGGGTCAAATTTCTAATATCTGCAGTAGTTGGT
CTGGTAGCGGTGCTTACTTCGGTTGAGATGCCTAAATCAGATCCATGGGTAATTATTGCCATTCTCTCCACAGTGCTTGG
TTATTGTGCGAAAACATACTTCACGTTCCAGCAGAACATGGCTACGTATCAGAACTTGATAACTCAGTCAATGTATGATA
AACAACTAGACAGCGGGAGGGGAACGCTACTACATTTGTGTGATGATGTGATTCAGCAAGAAGTAAAAGAGGTAATGATT
TGCTTCTACATACTAATGGAGCAGGGGAAAGCTACCTTGGAGGATCTGGATTTGAGGTGCGAGGAACTGATAAAGGAAGA
GTTTGGTGCGAGGTGTAACTTTGATGTAGAAGATGCAGTCCAGAAGCTAGAGAAGTTGGGGATAGTTGCTCGGGACACTA
TTGGAAGGTACTACTGCATGGGGCTGAAGCGAGCCAACGAGATTATAGGGACTACCACGGAGGAGCTTGTCCTCAAGGCC
AAACAGGGCGTCACACCTTCTTGA