Details for Arabidopsis Locus AT3G19320

Position : Chr3 ( 5`- 6696395 .. 6698073 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19320

Protein [Map View]
MAPNYYPSIFLILSVHFLSILATGNNHNTYRKSLEIIIGGGSDSTNYNSPAPSPEPEDYLPLPPPPQTPPPPPPPQSLPP
PSPSPEPEHYPPPPYHHYITPSPPPPRPLPPPPPPPLHFSSPLIKKVYPVIKNFQTLIEDDPKSILKTWVGTDICAQDKY
IGLECAKLPGTNDLALASIQFNNFNLGGKKLRLDNFLNKLEEVTIFHANSNNFVGSVPNFSKLKYLFELDLSNNKLSGEF
PSSVLKATNLTFLDLRFNSFSGSVPPQVFNLDLDVLFINNNNLVQRLPENLGSITALYLTFANNRFTGPIPGSIGDIKSL
QEVLFLNNKLTGCLPYQIGNLNRATVFDVELNQLTGPIPYSFGCLKKMEQLNLARNNFYGTIPEIVCELSALKNLSLSYN
YFTQVGPKCRTLIKRKILDVGMNCILDLTNQRTPWECAKFFLRKQSCPNFKSFFYLPCGKDPHRIKPDQEGSDGQASPPV
SYNALNPDRIRNL*

DNA
ATGGCCCCAAATTATTATCCTTCCATTTTCTTGATTCTGTCTGTTCACTTTCTTTCAATTCTAGCCACCGGAAACAACCA
CAACACCTACAGAAAATCTCTCGAAATCATCATCGGCGGTGGCAGTGATAGCACCAATTACAATTCTCCTGCGCCATCTC
CGGAGCCAGAAGACTATCTTCCGCTGCCTCCTCCTCCTCAAACGCCACCACCCCCGCCGCCACCACAGTCACTCCCTCCT
CCATCCCCATCTCCGGAGCCTGAACACTATCCTCCCCCTCCTTATCATCATTATATAACACCATCACCACCGCCACCACG
GCCACTTCCTCCTCCACCGCCACCGCCGCTACATTTCTCAAGCCCATTAATAAAGAAAGTTTATCCAGTCATCAAGAATT
TCCAGACGCTAATCGAAGATGATCCAAAGAGCATACTTAAAACATGGGTAGGCACCGACATTTGCGCTCAGGACAAATAC
ATAGGACTCGAGTGCGCCAAGTTACCGGGAACAAACGACCTCGCACTTGCCAGCATTCAGTTCAACAATTTTAACTTGGG
TGGCAAGAAACTCCGGCTAGATAACTTCCTCAACAAGTTAGAAGAAGTCACCATCTTTCACGCAAACAGTAACAATTTTG
TGGGCTCTGTTCCAAACTTCAGCAAATTGAAGTACCTTTTCGAGCTTGATCTCAGCAACAATAAGCTCTCTGGAGAGTTC
CCAAGCTCTGTGTTAAAAGCAACGAACCTCACGTTTCTCGATCTCAGATTCAATTCTTTCTCCGGTTCTGTCCCTCCTCA
GGTTTTCAATCTAGACCTCGACGTATTGTTCATCAACAACAACAATCTTGTTCAGAGACTCCCTGAAAATCTTGGATCGA
TCACCGCTCTTTACCTCACATTCGCTAATAACAGATTCACAGGTCCTATTCCGGGAAGCATTGGTGACATCAAGTCCCTA
CAAGAAGTCCTTTTCTTGAATAACAAGTTAACTGGTTGCTTACCGTACCAAATTGGGAACCTTAACCGAGCTACGGTTTT
CGATGTTGAGTTAAACCAGTTAACCGGTCCGATTCCGTACTCTTTCGGATGCCTAAAGAAGATGGAGCAGCTGAATTTGG
CTAGAAACAATTTCTACGGTACTATACCGGAGATTGTCTGCGAGCTCTCAGCCCTCAAGAACCTTTCTCTCTCGTACAAT
TACTTCACACAGGTCGGTCCAAAATGTCGAACACTCATCAAGAGGAAGATTCTTGATGTGGGTATGAATTGTATTCTAGA
TCTTACGAATCAAAGAACACCATGGGAATGCGCCAAGTTTTTCTTGCGGAAACAGAGTTGTCCTAACTTTAAGTCTTTCT
TTTATCTCCCTTGTGGCAAAGATCCCCACCGGATTAAACCGGATCAAGAAGGATCAGACGGTCAGGCTTCGCCACCGGTA
TCTTACAATGCTCTTAACCCAGACCGGATTCGGAATCTCTAG