Details for Arabidopsis Locus AT3G19310

Position : Chr3 ( 5`- 6694196 .. 6696214 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19310

Protein [Map View]
MFQRFTFFLTALLIPCILIILSPSYALKEGETCIVSKNCDRGLHCESCLASDSFRPRCSRMQPINPTTKVKGLPYNKYSW
LTTHNSFARMGAKSGTGSMILAPSNQQDSITSQLLNGVRGFMLDLYDFQNDIWLCHSYGGNCFNYTAFQPAVNILKEFQV
FLDKNKDVVVTLILEDYVKSPNGLTRVFDASGLRNFMFPVSRMPKNGEDWPTLDDMICQNQRLLVFTSNPQKEASEGIAF
MWRYMIENQYGDGGMKAGVCTNRPESVAMGDRSRSLILVNYFPDTADVIGSCKQNSAPLLDTVKNCQEASGKRWPNFIAV
DFYKRSDGGGAPKAVDVANGHAVCGCEDIAACKENMPYGTCEKQEEKKPESNLMMIAKLTAEATKGYGHPSTKPTLLGLS
VFVVTFVSLLSTF*

DNA
ATGTTTCAGAGATTCACCTTCTTTCTAACAGCTCTTCTCATTCCATGTATTCTAATTATCCTTAGCCCTTCATATGCCCT
CAAGGAAGGAGAAACATGCATCGTGAGCAAGAATTGTGATCGGGGATTACACTGTGAATCGTGTCTCGCCAGCGATAGTT
TCCGACCTAGATGCTCCCGAATGCAACCCATTAACCCGACCACCAAGGTAAAAGGGTTGCCTTACAACAAGTACTCATGG
TTAACAACCCACAATTCATTTGCTCGAATGGGTGCAAAATCAGGCACTGGCTCTATGATTCTTGCACCTTCCAACCAACA
AGATTCAATCACAAGCCAACTCCTTAATGGTGTTAGAGGGTTTATGCTTGACTTGTACGACTTCCAAAACGATATATGGC
TTTGCCATTCTTACGGTGGAAATTGTTTCAATTACACCGCATTCCAACCCGCGGTTAACATTTTAAAGGAGTTTCAAGTG
TTTCTAGACAAGAACAAGGATGTTGTTGTAACGCTTATCCTCGAGGACTATGTGAAATCTCCTAATGGTTTAACCAGAGT
GTTTGATGCATCCGGATTACGAAACTTCATGTTTCCGGTATCAAGAATGCCTAAAAACGGAGAAGATTGGCCTACTCTTG
ATGATATGATATGTCAGAACCAACGATTGCTTGTTTTCACGTCTAATCCTCAAAAAGAAGCGTCGGAGGGAATTGCGTTT
ATGTGGAGATACATGATAGAGAATCAATATGGAGATGGAGGGATGAAGGCTGGAGTGTGTACCAATAGACCGGAATCAGT
TGCAATGGGAGATAGATCAAGATCACTTATTCTAGTCAATTATTTTCCGGATACTGCAGATGTGATCGGATCTTGTAAGC
AGAACTCTGCTCCTCTTCTTGACACCGTCAAAAACTGTCAAGAAGCCTCGGGAAAACGTTGGCCTAACTTCATTGCAGTC
GATTTCTACAAGAGAAGCGATGGTGGAGGAGCTCCAAAAGCAGTGGATGTTGCAAACGGTCATGCAGTTTGCGGCTGCGA
AGATATAGCCGCTTGTAAAGAGAACATGCCATATGGGACGTGTGAGAAGCAAGAAGAGAAGAAACCGGAATCAAACCTAA
TGATGATAGCAAAACTTACCGCGGAAGCGACTAAAGGCTATGGCCACCCATCTACCAAACCGACCCTACTTGGGCTTTCT
GTGTTTGTTGTAACCTTTGTCTCACTTCTCTCAACTTTTTGA