Details for Arabidopsis Locus AT3G19300

Position : Chr3 ( 5`- 6690118 .. 6693284 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19300

Protein [Map View]
MVLVYNQALLLAFFALLGFQYFPLLTEAGCPLDFTSSNFTLVASVCSNNTERAKCCRYMNAFVAISVARYANYTADLGVT
SDLTEICITTISRTMELYGIPRNATIFCGLGTKILVNYDCEGLTTVPPMLHSTSFGDVSRNCKLPLPPGDQCRNCLNSSI
SYLRSLVGADNSIKLSTCRDATYAVLASRVDNSSALELASCFFNVPELSPTPGSSPSSLSPEASPPVLADSPSSDNLVLS
PLKSHHPYHLTMVPTIGIAVTVFALVMVVVLIVLIQRKKRELDDSKSIACNLTRTSPSPRPRSMIHEGNSFGFRKFSYKE
IRKATEDFNAVIGRGGFGTVYKAEFSNGLVAAVKKMNKSSEQAEDEFCREIELLARLHHRHLVALKGFCNKKNERFLVYE
YMENGSLKDHLHSTEKSPLSWESRMKIAIDVANALEYLHFYCDPPLCHRDIKSSNILLDEHFVAKLADFGLAHASRDGSI
CFEPVNTDIRGTPGYVDPEYVVTHELTEKSDVYSYGVVLLEIITGKRAVDEGRNLVELSQPLLVSESRRIDLVDPRIKDC
IDGEQLETVVAVVRWCTEKEGVARPSIKQVLRLLYESCDPLHLGLAMAVEENKGRSLRGDSGFQSGDIRGLASSSSTTSR
SHCSRSFLLETGSPHSPPNGLSF*

DNA
ATGGTGTTGGTTTATAATCAAGCTCTCTTGCTCGCATTCTTCGCATTGCTTGGATTCCAGTACTTTCCTTTACTCACCGA
AGCAGGTTGTCCATTGGACTTTACTTCATCTAACTTCACTCTAGTGGCTTCCGTATGCTCGAACAACACCGAGAGAGCTA
AATGCTGCCGCTACATGAATGCTTTCGTTGCAATATCTGTCGCCCGCTATGCAAACTACACAGCTGATCTTGGAGTTACA
TCAGATTTGACTGAAATCTGTATCACTACTATCTCTAGAACCATGGAGCTTTATGGAATCCCAAGAAATGCTACCATCTT
CTGTGGATTAGGGACCAAGATTCTTGTTAACTATGATTGTGAGGGTCTGACTACTGTACCGCCAATGCTTCATTCCACAA
GTTTTGGAGATGTTTCCAGAAACTGCAAACTCCCGCTTCCTCCGGGTGATCAATGCAGGAATTGTTTGAATTCCAGTATC
AGCTACCTTAGGAGCCTCGTTGGTGCTGATAATAGCATCAAACTGAGTACTTGTCGTGATGCAACTTATGCTGTGTTAGC
AAGCCGGGTTGACAATTCATCGGCTCTTGAACTAGCTAGCTGCTTCTTTAATGTGCCTGAGCTTAGCCCCACTCCAGGTT
CGTCTCCATCATCGCTGAGTCCAGAAGCTTCTCCTCCAGTGTTAGCTGATAGTCCAAGCAGCGATAATCTTGTTTTGTCT
CCATTAAAAAGTCACCATCCATATCACTTGACAATGGTTCCGACTATTGGGATTGCTGTCACAGTTTTTGCTCTTGTGAT
GGTTGTAGTCCTAATAGTTCTTATCCAAAGAAAAAAACGAGAACTTGATGACTCCAAGAGCATCGCTTGTAATCTAACAA
GGACATCTCCTTCTCCCCGCCCAAGGTCGATGATTCATGAAGGTAATTCGTTTGGTTTTCGGAAATTCAGCTACAAGGAG
ATAAGGAAAGCAACTGAAGATTTCAACGCGGTGATTGGCCGTGGGGGCTTTGGGACTGTTTACAAAGCTGAGTTCAGTAA
TGGGTTGGTTGCAGCTGTAAAAAAGATGAACAAGAGCTCTGAACAAGCTGAAGATGAATTTTGCAGAGAGATAGAGCTTC
TCGCCAGGCTGCATCACCGCCACCTAGTTGCTTTGAAAGGGTTTTGTAATAAGAAGAACGAGAGGTTCCTTGTCTACGAG
TATATGGAAAATGGGAGCCTGAAGGATCATCTACACTCCACGGAAAAATCTCCACTAAGTTGGGAATCAAGGATGAAAAT
CGCAATTGATGTGGCTAATGCTCTGGAATACCTTCACTTCTACTGTGACCCTCCCCTCTGTCACAGAGACATTAAGTCAA
GCAATATATTACTCGACGAGCACTTTGTTGCTAAGCTTGCAGATTTTGGCCTTGCACATGCTTCTAGAGATGGCTCCATT
TGTTTTGAACCTGTTAATACTGATATCCGCGGAACTCCAGGCTATGTAGATCCAGAGTACGTTGTAACACATGAACTAAC
AGAGAAAAGCGACGTGTACAGCTACGGAGTGGTGTTGCTAGAGATCATAACTGGGAAAAGAGCGGTTGATGAAGGTAGGA
ACCTGGTAGAACTGTCTCAGCCTTTGCTGGTATCAGAATCAAGACGCATAGATCTGGTGGATCCGAGAATCAAAGACTGC
ATAGATGGAGAACAGCTTGAAACAGTAGTGGCAGTTGTAAGATGGTGCACAGAGAAAGAAGGCGTGGCTAGGCCATCAAT
CAAGCAAGTTCTGAGGCTGTTGTACGAAAGCTGTGATCCGTTGCATCTCGGGCTTGCAATGGCAGTTGAAGAGAACAAAG
GACGGTCACTGAGAGGTGACTCAGGGTTCCAAAGTGGAGACATCCGTGGCTTGGCTTCTTCCTCTAGTACTACTTCAAGG
TCGCATTGTAGCCGGAGTTTTCTGCTTGAGACTGGCTCCCCTCACTCTCCACCAAATGGTCTCTCTTTTTGA