Details for Arabidopsis Locus AT3G19280

Position : Chr3 ( 5`- 6681196 .. 6683892 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19280

Protein [Map View]
MGVFSNLRGPKIGLTHEELPVVANGSTSSSSSPSSFKRKVSTFLPICVALVVIIEIGFLCRLDNASLVDTLTHFFTKSSS
DLKVGSGIEKCQEWLERVDSVTYSRDFTKDPIFISGSNKDFKSCSVDCVMGFTSDKKPDAAFGLSHQPGTLSIIRSMESA
QYYQENNLAQARRKGYDIVMTTSLSSDVPVGYFSWAEYDIMAPVQPKTEKALAAAFISNCAARNFRLQALEALMKTNVKI
DSYGGCHRNRDGSVEKVEALKHYKFSLAFENTNEEDYVTEKFFQSLVAGSVPVVVGAPNIEEFAPSPDSFLHIKQMDDVK
AVAKKMKYLADNPDAYNQTLRWKHEGPSDSFKALIDMAAVHSSCRLCIFVATRIREQEEKSPEFKRRPCKCTRGSETVYH
LYVRERGRFDMESIFLKDGNLTLEALESAVLAKFMSLRYEPIWKKERPASLRGDGKLRVHGIYPIGLTQRQALYNFKFEG
NSSLSTHIQRNPCPKFEVVFV*

DNA
ATGGGTGTTTTCTCCAATCTTCGAGGTCCTAAAATTGGATTGACCCATGAAGAATTGCCTGTAGTAGCCAATGGCTCTAC
TTCTTCTTCTTCGTCTCCTTCCTCTTTCAAGCGTAAAGTCTCGACCTTTTTGCCAATCTGCGTGGCTCTTGTCGTCATTA
TCGAGATCGGGTTCCTCTGTCGGCTCGATAACGCTTCTTTGGTCGATACGTTAACCCATTTTTTCACCAAGTCGTCGTCC
GATTTGAAAGTTGGGTCAGGAATAGAGAAATGCCAGGAGTGGTTAGAGAGAGTGGATTCAGTTACTTATTCTAGAGATTT
CACTAAAGATCCGATTTTTATCTCTGGTAGTAACAAGGACTTCAAATCGTGCTCTGTTGATTGTGTAATGGGATTCACTT
CAGATAAGAAACCTGATGCGGCTTTTGGATTAAGTCATCAACCTGGAACACTCAGTATAATCCGTTCCATGGAATCAGCA
CAGTATTACCAAGAGAATAATCTTGCTCAAGCACGACGGAAAGGTTATGATATTGTGATGACAACTAGTCTGTCATCAGA
TGTTCCTGTTGGGTATTTTTCATGGGCGGAATATGATATTATGGCTCCAGTGCAACCAAAAACAGAGAAAGCTCTTGCTG
CTGCTTTTATTTCCAATTGCGCCGCTCGGAATTTCCGCCTGCAAGCTCTTGAAGCCTTAATGAAGACGAATGTTAAGATT
GATTCTTATGGTGGTTGTCACCGGAATCGGGATGGGAGTGTGGAGAAGGTTGAAGCTCTTAAGCACTACAAATTCAGTCT
AGCTTTTGAGAACACCAACGAGGAGGATTATGTCACAGAGAAGTTCTTCCAATCTCTAGTCGCTGGATCTGTCCCTGTGG
TTGTTGGAGCTCCAAATATAGAAGAATTTGCACCTTCTCCTGACTCATTCCTTCACATTAAGCAGATGGATGATGTCAAG
GCAGTTGCAAAGAAAATGAAGTATCTTGCGGATAACCCTGACGCCTATAATCAGACGCTAAGATGGAAACATGAAGGCCC
TTCAGATTCTTTTAAGGCACTTATTGATATGGCTGCTGTACACTCTTCTTGTCGTCTCTGCATCTTTGTGGCTACAAGGA
TTCGTGAGCAAGAAGAGAAGAGCCCTGAGTTTAAGAGACGACCCTGCAAATGCACCAGAGGCTCAGAGACAGTTTATCAT
TTGTATGTTAGAGAAAGAGGACGGTTTGACATGGAATCCATCTTCTTGAAGGATGGAAATCTGACTCTGGAAGCTCTGGA
ATCTGCGGTTCTTGCGAAGTTCATGTCTCTGAGATATGAACCAATATGGAAGAAGGAAAGACCCGCGAGCTTAAGAGGAG
ACGGCAAGCTTAGAGTACATGGGATATATCCTATTGGTCTGACTCAAAGACAAGCTCTTTACAACTTCAAATTCGAAGGA
AATTCAAGTCTCAGTACTCACATACAGAGAAACCCTTGTCCCAAATTCGAAGTTGTCTTTGTCTAA