Details for Arabidopsis Locus AT3G19250

Position : Chr3 ( 5`- 6666842 .. 6668395 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19250

Protein [Map View]
MPHCFTFKPASPEGSLGDDHLPHPSPEGSVASTFNLSHELAHAFQTPSYHDIRSRLLVIDPTQENLELFLSQELRPNNES
VQEALSLRHAKQTTLTNLVSTYFQHSEDATRFCLNLYQNVHSARCHLYTPLLDLFNIFPRDSHSAIDESFCNLAFDVFLK
LDTFENPFASPESHSFQDTQLCFYQLADKLDTRIRKSKSRVRLLHHATAGSALCLVTAVVVVAASAAFIAYHALPTILVV
AGPLCTPYLPHSFKKKELSNIFQLNVAAKGTFALNKDLDTIDRLVSRLHTGVKNDKLLIRLGLERGRDVYTIPEFVKQLR
KSHVNHTHQLEVLVDHICRWFTNVNKSRSLLLKEILRPQT*

DNA
ATGCCGCACTGTTTTACCTTCAAGCCAGCTTCTCCAGAGGGCTCTCTCGGCGACGACCATCTTCCCCATCCTTCCCCAGA
GGGAAGTGTTGCCTCCACTTTTAACCTCAGCCACGAGTTAGCTCATGCTTTTCAAACCCCGTCGTACCACGACATACGTT
CACGGCTTCTTGTTATTGACCCAACACAAGAAAATCTCGAGCTGTTTCTTTCTCAAGAGCTCAGACCAAACAACGAATCC
GTTCAAGAAGCTCTTAGTCTTAGACACGCCAAGCAAACTACACTTACCAATCTTGTCTCTACTTACTTCCAACACAGCGA
AGACGCCACCCGATTTTGCTTGAATCTTTACCAAAACGTCCACAGTGCTCGCTGCCACCTCTACACACCCCTCTTAGACC
TCTTCAATATCTTTCCCCGTGATTCCCATTCCGCAATTGACGAGTCCTTCTGTAACTTAGCATTCGACGTTTTTCTTAAG
CTTGACACGTTTGAAAACCCTTTCGCATCTCCTGAATCTCACAGCTTTCAAGACACCCAATTATGCTTTTATCAGCTGGC
TGACAAGCTGGACACCCGTATTCGTAAGTCTAAGTCACGGGTCCGCCTCCTCCATCATGCCACAGCTGGTTCTGCCTTAT
GTCTTGTAACTGCTGTTGTTGTGGTTGCTGCTTCTGCGGCATTTATCGCATATCATGCACTTCCCACCATTCTTGTTGTT
GCAGGTCCCTTGTGCACTCCCTACCTCCCTCACAGTTTCAAGAAGAAGGAGTTGTCTAACATTTTTCAGCTAAATGTTGC
TGCCAAGGGTACTTTTGCGCTCAACAAAGATCTTGACACCATTGACCGTCTTGTCTCCCGTTTGCACACGGGGGTTAAAA
ACGACAAGCTTCTTATTCGCCTTGGATTAGAGAGGGGGAGGGACGTGTATACAATTCCGGAGTTTGTGAAACAGCTTCGA
AAGAGCCATGTTAACCACACCCATCAACTCGAGGTTCTTGTGGATCATATATGTCGTTGGTTCACTAATGTTAACAAATC
CAGATCGTTGCTCCTTAAAGAGATCCTTCGTCCCCAAACGTAA