Details for Arabidopsis Locus AT3G19240

Position : Chr3 ( 5`- 6664250 .. 6666558 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19240

Protein [Map View]
MGTSQSREDRISESDTESDSDYYEEEDEDQYDDAKKQGSSSVSGTRPSDSSSSSGPTDSSSLDIEQKLKALKLKYPSSSS
VTPKMKNAVKLYRHIGGNTPKAKWIVSDKMTSYKFVKTSSVDGEDIDDYDDCEESGEGGESFWFLGVGTKVKARVSTDMQ
LKMFGDQRRVDFVSNGVWALKFLTDEDYRKFVTRFQDYLFENVYKIRASEENRVKVYGKDFIGWANPEAADDSMWEDAEA
PPEEEETQGKRNTDLTEEFEEVANGGVQSLTLGALDNSFLVNDYGVQVYRNMERGIHGKGVCVRFDSGNSKFGSGSSQTT
PNKALLMRAETNMMLMSPAKQGKPNSTGVKQLDIESGKIVTEWKFEKDGTEITMRDITNDTKGSQLDPSESTFLGLDDNR
LCQWDMRDRRGIVQNIDSPILEWTQGHQFSRGTNFQCFATTGDGSIVVGSLDGKIRLYSKTSMRMAKTAFPGLGSPITHV
DVSYDGKWILGTTDTYLVLICTLFTDKNGLTKTGFSGRMGNKIPAPRLLKLTPLDSHLAGKDNKFHGGHFSWVTESGKQE
RHIVATVGKFSVIWDLERVKNSAHECYRNQQGLKSCYCYKILLKDESIVESRFMHDNFSFSGNKSPEAPLVVATPLKVSS
ISLSGKRL*

DNA
ATGGGTACTTCTCAGAGTCGTGAAGATCGAATCAGCGAATCGGATACAGAATCCGATTCAGATTACTATGAAGAAGAAGA
CGAGGATCAATACGATGACGCGAAGAAGCAAGGATCATCATCTGTTTCTGGTACAAGACCGTCTGATTCTTCTTCTTCTT
CAGGACCAACTGATTCATCGTCTCTCGATATTGAGCAGAAGCTAAAAGCCTTGAAGTTGAAATACCCATCTTCTTCTTCC
GTAACACCCAAGATGAAGAACGCTGTGAAGCTTTACCGCCATATCGGGGGAAACACACCCAAAGCGAAATGGATCGTTTC
GGATAAGATGACATCATACAAGTTTGTGAAAACTTCGTCAGTGGATGGAGAAGATATTGATGATTATGATGATTGTGAAG
AATCAGGTGAAGGAGGTGAGTCTTTTTGGTTTCTGGGTGTTGGTACTAAGGTTAAAGCTAGGGTTTCTACGGATATGCAG
TTGAAAATGTTTGGGGATCAACGTAGGGTTGACTTTGTTAGTAATGGTGTTTGGGCTTTGAAGTTCTTGACGGATGAGGA
TTATAGGAAGTTTGTTACTAGGTTTCAGGACTATCTGTTTGAGAATGTGTATAAGATCAGGGCAAGTGAGGAGAATAGAG
TTAAAGTGTATGGTAAAGATTTCATTGGGTGGGCTAATCCTGAGGCTGCTGATGATTCTATGTGGGAGGATGCTGAAGCT
CCACCTGAGGAAGAGGAAACTCAGGGGAAGAGGAATACGGATTTGACGGAAGAGTTTGAAGAGGTGGCTAATGGTGGAGT
GCAGAGTTTGACTTTGGGAGCGTTGGATAATTCGTTCTTGGTGAATGATTATGGGGTTCAGGTTTATAGGAATATGGAGC
GTGGTATTCATGGGAAAGGTGTGTGCGTGAGATTTGATTCTGGAAACTCAAAGTTCGGATCAGGGTCAAGCCAGACAACA
CCGAACAAGGCTCTTTTGATGAGGGCAGAGACTAATATGATGCTGATGAGTCCAGCTAAACAAGGGAAACCTAACTCCAC
TGGTGTTAAGCAGCTCGATATAGAGTCAGGGAAGATTGTTACTGAATGGAAATTTGAGAAAGACGGGACTGAAATCACGA
TGAGAGACATAACAAATGATACCAAAGGGTCGCAGCTAGATCCATCAGAGTCAACGTTTTTGGGATTGGATGACAATAGG
CTGTGTCAATGGGACATGAGGGATAGGAGAGGTATAGTGCAGAACATTGACTCTCCCATCTTGGAATGGACTCAAGGCCA
TCAGTTCTCTAGAGGAACAAATTTCCAGTGCTTTGCAACTACTGGAGATGGGTCAATCGTTGTGGGATCACTTGACGGAA
AGATAAGACTTTACTCAAAGACCTCAATGAGAATGGCAAAAACGGCTTTTCCAGGGCTCGGTTCACCAATTACACATGTG
GACGTTTCTTATGATGGGAAATGGATACTGGGCACCACAGATACGTACTTGGTTCTTATTTGCACCCTTTTCACAGACAA
AAATGGTCTGACAAAAACAGGCTTTAGCGGAAGAATGGGAAACAAAATACCAGCCCCTAGGCTGCTGAAGCTAACACCAC
TAGATTCACACTTGGCAGGAAAAGATAATAAGTTTCATGGCGGTCACTTCTCATGGGTAACTGAGAGTGGAAAGCAAGAG
AGACACATAGTAGCAACAGTGGGGAAATTCAGTGTGATATGGGACTTGGAGCGGGTGAAGAACAGTGCACACGAATGCTA
TAGGAACCAACAAGGACTCAAGAGCTGTTACTGCTACAAGATCTTGTTGAAGGATGAGTCAATTGTTGAGAGCCGATTCA
TGCACGATAACTTCTCCTTCTCCGGTAACAAATCGCCAGAAGCACCGCTTGTGGTTGCCACGCCTTTGAAAGTCAGCTCC
ATCAGCCTCTCTGGAAAACGACTTTAA