Details for Arabidopsis Locus AT3G19220

Position : Chr3 ( 5`- 6659164 .. 6660852 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19220

Protein [Map View]
MFRLYPNCSLPSHRPLVFLPRLPSRSLRCRAAADIPLGDGIRLPREADSTSDTARSRDVSVAAGGNGEGAKWRKRRLLWS
KSGESYLVDDGDALPLPMTYPDTSPVSPDVIDRRLQCDPVVEDCREVVYEWTGKCRSCQGSGTVSYYKKRGKEVICKCIP
CQGIGYVQKITSRTDIEVMEDLDNEPS*

DNA
ATGTTCCGATTATACCCTAATTGCTCTCTGCCTTCTCACAGACCTCTCGTTTTCCTTCCTCGTCTTCCTTCTCGCTCCCT
CCGTTGCCGCGCCGCCGCTGATATTCCCCTTGGTGACGGAATCCGATTACCTCGAGAAGCGGATTCAACCTCTGACACGG
CGAGGTCTCGGGATGTTTCCGTCGCCGCCGGTGGGAATGGTGAAGGTGCTAAGTGGAGGAAGAGGAGGTTGCTCTGGTCG
AAAAGTGGAGAGAGTTACTTGGTAGATGATGGCGACGCGCTTCCTCTTCCTATGACTTATCCTGATACATCCCCTGTGTC
GCCGGATGTGATTGACCGGAGGTTGCAATGTGATCCTGTAGTCGAGGATTGCCGGGAAGTGGTTTATGAATGGACTGGAA
AGTGTAGAAGTTGCCAAGGATCTGGAACTGTCAGCTATTACAAGAAAAGGGGTAAAGAGGTTATATGCAAATGCATACCC
TGCCAAGGGATAGGATATGTGCAGAAGATAACATCTCGGACGGACATTGAAGTGATGGAAGATTTGGATAATGAACCATC
TTGA