Details for Arabidopsis Locus AT3G19210

Position : Chr3 ( 5`- 6652745 .. 6658988 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19210

Protein [Map View]
MEEEDEEILSSSDCDDSSDSYKDDSQDSEGENDNPECEDLAVVSLSSDADRKSKNVKDLLRGNLVVQRQPLLPRVLSVSD
GAAVCRKPFKPPCSHGYDSTGQLSRRLSARKRFVPWGSSTPVVVALPTKLEASTNIERDEEEEVVCLPPDIEPLVLWQSE
EDGMSNVTTIMVHSVLVKFLRPHQREGVQFMFDCVSGLHGSANINGCILADDMGLGKTLQSITLLYTLLCQGFDGTPMVK
KAIIVTPTSLVSNWEAEIKKWVGDRIQLIALCESTRDDVLSGIDSFTRPRSALQVLIISYETFRMHSSKFCQSESCDLLI
CDEAHRLKNDQTLTNRALASLTCKRRVLLSGTPMQNDLEEFFAMVNFTNPGSLGDAAHFRHYYEAPIICGREPTATEEEK
NLAADRSAELSSKVNQFILRRTNALLSNHLPPKIIEVVCCKMTTLQSTLYNHFISSKNLKRALADNAKQTKVLAYITALK
KLCNHPKLIYDTIKSGNPGTVGFENCLEFFPAEMFSGRSGAWTGGDGAWVELSGKMHVLSRLLANLRRKTDDRIVLVSNY
TQTLDLFAQLCRERRYPFLRLDGSTTISKRQKLVNRLNDPTKDEFAFLLSSKAGGCGLNLIGANRLVLFDPDWNPANDKQ
AAARVWRDGQKKRVYVYRFLSTGTIEEKVYQRQMSKEGLQKVIQHEQTDNSTRQGNLLSTEDLRDLFSFHGDVRSEIHEK
MSCSRCQNDASGTENIEEGNENNVDDNACQIDQEDIGGFAKDAGCFNLLKNSERQVGTPLEEDLGSWGHHFTSKSVPDAI
LQASAGDEVTFVFTNQVDGKLVPIESNVSPKTVESEEHNRNQPVNKRAFNKPQQRPREPLQPLSLNETTKRVKLSTYKRL
HGNSNIDDAQIKMSLQRPNLVSVNHDDDFV*

DNA
ATGGAGGAAGAAGATGAAGAGATCTTATCGTCTTCCGATTGCGACGATTCCAGCGATAGTTACAAGGATGATTCTCAAGA
TTCTGAAGGAGAAAACGATAACCCTGAGTGCGAAGACCTTGCGGTGGTTTCTCTTTCATCCGACGCAGATCGGAAATCTA
AGAACGTAAAGGATCTTCTGAGGGGCAATCTAGTTGTGCAACGGCAGCCACTCCTTCCTCGGGTGCTTTCGGTGTCAGAT
GGAGCGGCAGTTTGTAGGAAGCCTTTCAAACCTCCGTGTTCTCATGGTTATGATTCCACAGGACAACTTTCTCGTCGCCT
TTCAGCTCGAAAACGGTTTGTTCCTTGGGGTTCCTCAACTCCGGTTGTGGTTGCTTTACCTACTAAGCTGGAAGCATCAA
CCAATATTGAGAGAGATGAAGAAGAGGAAGTTGTTTGTCTACCACCTGATATTGAACCTTTGGTATTGTGGCAATCTGAA
GAAGATGGAATGAGCAATGTAACAACTATCATGGTGCATTCAGTGCTTGTCAAATTTCTTCGCCCTCATCAAAGAGAGGG
TGTCCAGTTCATGTTCGATTGTGTTTCAGGATTACATGGTTCGGCAAATATAAATGGTTGCATTCTGGCTGATGACATGG
GTTTAGGGAAGACATTACAGTCCATTACTTTACTATACACACTTCTTTGTCAAGGATTTGATGGGACGCCTATGGTTAAA
AAGGCCATTATTGTTACACCAACGAGTCTTGTCAGTAACTGGGAAGCTGAAATTAAGAAATGGGTTGGAGACAGGATTCA
GCTTATAGCCCTCTGTGAGAGCACCAGAGATGATGTTTTGTCTGGAATAGATAGTTTCACTCGACCAAGAAGCGCTTTGC
AGGTACTTATCATTTCTTACGAGACATTCCGAATGCACTCATCCAAGTTCTGCCAGAGTGAATCCTGTGATCTTCTAATA
TGCGATGAGGCTCATAGGTTGAAAAATGACCAGACACTTACAAACAGGGCTTTGGCTTCATTGACATGCAAACGTCGAGT
TTTGTTGTCTGGAACTCCCATGCAGAATGACTTGGAAGAGTTTTTTGCCATGGTCAACTTCACAAATCCAGGGAGTTTAG
GTGATGCTGCACACTTTCGCCATTATTATGAGGCACCTATTATATGTGGAAGAGAACCTACAGCCACTGAGGAAGAGAAA
AACTTAGCTGCTGACCGCTCCGCAGAACTGAGTTCAAAAGTCAACCAGTTTATTTTGAGGAGAACCAATGCATTGCTCTC
AAATCACCTACCACCTAAGATAATTGAAGTAGTTTGTTGCAAGATGACTACTCTCCAGTCCACTTTGTACAACCATTTTA
TTAGCTCGAAAAATCTTAAAAGGGCGCTTGCTGATAATGCAAAACAAACCAAAGTTTTGGCTTATATAACAGCTCTTAAG
AAGCTCTGCAATCATCCAAAGCTAATCTACGACACAATAAAAAGCGGCAATCCTGGAACTGTTGGGTTTGAGAATTGCTT
AGAGTTCTTCCCTGCAGAAATGTTCTCTGGGAGATCTGGAGCATGGACAGGGGGTGATGGTGCCTGGGTCGAGCTCTCTG
GGAAAATGCATGTTCTCTCCAGACTTTTGGCCAACCTACGTCGAAAAACTGATGACCGCATAGTCCTTGTATCAAACTAC
ACACAGACATTGGATCTTTTTGCTCAACTCTGTCGTGAAAGAAGATATCCTTTTCTGAGGCTGGATGGATCAACAACAAT
CAGCAAGAGGCAGAAGCTTGTTAACCGGTTGAACGACCCAACAAAGGATGAGTTTGCATTTCTCTTAAGCAGCAAGGCGG
GTGGCTGTGGATTAAATTTAATTGGTGCTAATCGACTTGTTTTGTTCGATCCTGATTGGAATCCTGCCAATGATAAACAA
GCTGCTGCTAGAGTTTGGAGGGATGGGCAAAAGAAAAGAGTATATGTCTACAGGTTTCTTAGTACTGGAACTATTGAAGA
AAAGGTTTACCAGCGCCAGATGTCAAAAGAAGGGCTTCAAAAAGTTATTCAGCATGAACAGACGGATAACAGCACGAGAC
AGGGGAACTTACTTTCTACAGAGGATCTACGAGATTTATTTTCCTTCCATGGGGATGTTAGGTCTGAAATCCATGAAAAG
ATGAGCTGCAGCAGGTGCCAAAATGATGCCTCTGGTACTGAGAATATCGAAGAAGGGAATGAGAACAATGTAGATGACAA
TGCTTGCCAGATTGACCAAGAAGACATAGGCGGATTTGCAAAAGATGCAGGATGCTTTAACTTGTTAAAAAACTCTGAGA
GACAGGTGGGCACTCCATTGGAAGAAGATCTAGGAAGCTGGGGTCATCACTTTACCTCAAAATCCGTTCCAGATGCTATA
CTGCAAGCTTCAGCAGGTGACGAGGTGACGTTTGTTTTCACAAACCAGGTAGATGGGAAGCTCGTTCCCATCGAATCAAA
TGTCAGTCCAAAAACGGTGGAGTCCGAAGAGCACAATCGGAACCAACCTGTAAATAAGCGTGCCTTTAACAAACCACAAC
AAAGACCTCGGGAACCGCTGCAGCCGTTATCTCTCAACGAGACCACAAAAAGAGTGAAGTTGTCTACTTATAAGCGTTTA
CATGGTAATAGTAACATTGATGATGCTCAGATTAAAATGTCTTTGCAAAGACCAAATCTAGTTTCTGTAAATCACGATGA
TGATTTTGTATGA