Details for Arabidopsis Locus AT3G19190

Position : Chr3 ( 5`- 6639711 .. 6648857 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19190

Protein [Map View]
MVFPWNIAKSAEEAFSRWAVKRVVKFLLKKKLGKLILGDIDLDQLDIQLRDGTIQLSDLAINVDYLNDKFDAPLVIKEGS
IGSLLVKMPWKTNGCQVEVDELELVLAPRLESNKSSSNEASTSASTREDLHNIRLEIGKHENEMLMNAAKSASIDVHEGV
KTVAKIVKWFLTSFHVKIKNLIIAFDPDFGKKQSEAGPRPTLVLRMTEIECGISEEQVSANEVSPDNFLGINRLANCVKF
QGAVVELLNMDDDDDGDKTCDKKTSNDVTLIMTGVGGGFSGSLNFSIPWKNGSLDIRKVDADISIDPVEVRFQPSTIRWF
LQLWKTFTSFGSDCFPSVSHSDFLTDSPTIPTNVMVTPPATLSLSGGQELEHDTTPNLQFIPDWFPSSFSKKEEDGEVDI
GASVDQFFECFDAMRSYQSASGSQGMWNWTSSVFTAINAASSLASGSLLLPSEQQHVETSCKVSFAGVSVVLFFQDEVNW
KGVSTRIHYLGAELRDISVSFQVCLHDLRLEGEVNSMEIADYCQGGNVVDTANAESQTCLIKDLQAKVQTSLPPFASSDM
HSDSERLSEIVSDGFLFRNKGFAVKTLLVIAAGGSGFQFTVNFQSSKASHRGSNSFSLSLPPTTFWLNLHSVEMLVNLFN
DVSESIPITSHERNQVASSSKSESLRGSVSICNARVILWFPFESISERFCNSLGQQFIVVDLSSSPPSDKERAKERSPGE
MHFPSATRSICFSVGDASIYLVTSDLKDSETNSYHRQVEFSAYNILHTNNKTRHQLSTIGMFWQDRPTVSPWLVERAKML
ATQEESIQTDKSGGRGLEFAAVATPKDQDDIYSRSRKEIILASSFCLYVHLLPLAIHLDSWQYSKLCNLIEEAKNWLSRM
AANTAEQTEESVVCQTSLVVDCDSIDILVRPEPRMGIKKQLQTELPGSWIQFNLRVQKLNLMSVPNLGSVSGADFFWLAH
GEGTLLGSVTGLPDQELLLLSCNNSAIKRGNGGGSNALSSRFAGLDFLHLQEPGICNDYLAVSARGCTISAVGGRLDWIE
VATSFFSFEDEKKTQEINSSSSSGSSFILNFVDVGLSYEPHHENTDHLRQASDPWVACLVAASSFSLSKKSLVDSIRNDY
RIRIQDLGLLLSVDFDLSKLGGTYSSEHLHESGYVKVANDSLIEAILRTNSENGLLWELECSKSHLVIETCSDTTSGLIR
LATQLQQLLAPDLEESAVHLQTRWDSIQQANARNDLDISDRLSSSDSSGEMKYLRLESENETGVIGLMDEINEDAFQFDV
NPTYQSDSVECQNNYMSPHGISHGQAYNWVPATEKLPSNQSICGSSSRINSESSQVFLERESLPEIFENYCLSEFRPSSE
VPQEGDSSGRELFPETDLRRGNSGWYDDASLRIVEDHVSEATEEDHEEHILDGECSSFGQTSYSAVAANGRILLKNIDLK
WRIYSGSDWHDSRKKGENFKHTKGRDTTSCLELELSGVLGYYNSKDHPRDSSSYAFKLELKAVRPDPETPLEENRFFGAN
SLEKPVVSMGDSGGSTMSVSVQGHNIIEEALLPYFQKFDIWPVNVRVDYSPHHVDIAALTGGKYAELVNLVPWKGIELQL
KHVHAAGIYGWGNVCETILGEWLEDVSQNQIHQLLKGIPTVRSLSALYAAALKLVSSPVESYRKDRRLVKGVQRGTVAFL
RSISLEAVGLGVHLAAGAHDILLRAEYIFASSPSLPQPQGRTKTNVRHNQPRNAKQGMLKACESIGDGIGKTASALVRTP
LKKYQRGDGAGSAFATVVQGVPTAAIAPASACARAVHSALVGIRNRSIISPFSLDPEHKKESMEKYLGPDKQRKQDQHR*

DNA
ATGGTGTTTCCGTGGAACATTGCTAAATCAGCGGAGGAAGCTTTTTCTAGATGGGCGGTGAAGAGGGTTGTCAAATTCCT
GTTGAAGAAGAAATTGGGTAAACTCATACTTGGTGATATCGACCTTGATCAGCTCGATATTCAGCTTCGTGATGGCACTA
TTCAGCTCTCCGATCTTGCTATCAACGTTGACTATTTGAATGACAAGTTTGATGCTCCACTCGTCATAAAAGAAGGCTCA
ATTGGATCTTTGTTAGTTAAAATGCCTTGGAAGACCAATGGTTGTCAAGTTGAGGTTGACGAGCTGGAGCTTGTTCTTGC
ACCACGTTTGGAGAGTAATAAATCATCTTCAAATGAAGCCAGCACCTCCGCCTCTACACGAGAAGATTTACATAATATAC
GTCTTGAAATAGGAAAGCATGAGAATGAGATGTTGATGAATGCTGCAAAATCTGCGTCTATCGATGTCCATGAAGGTGTT
AAGACGGTTGCCAAGATAGTGAAATGGTTTCTTACTAGTTTTCACGTCAAAATTAAGAATCTGATTATAGCATTTGATCC
CGATTTTGGCAAAAAACAGTCTGAAGCTGGTCCTCGACCAACATTGGTACTTAGAATGACAGAAATAGAGTGTGGAATTT
CAGAGGAGCAAGTTTCGGCTAATGAAGTTTCTCCTGATAATTTCCTTGGTATTAATCGACTTGCAAACTGTGTGAAGTTT
CAAGGAGCCGTTGTAGAGCTTTTAAATATGGATGATGATGATGATGGCGACAAAACTTGTGATAAAAAGACATCAAATGA
TGTGACTTTGATCATGACAGGCGTAGGAGGTGGCTTTTCAGGGAGTTTAAATTTTAGTATACCCTGGAAGAATGGTTCTT
TAGACATTCGCAAGGTGGATGCTGATATTTCTATTGATCCTGTTGAAGTACGATTTCAACCGTCTACAATTAGATGGTTC
TTACAATTGTGGAAGACGTTCACAAGTTTTGGATCAGACTGTTTCCCCTCAGTTTCTCATTCTGATTTTTTGACGGATTC
ACCTACAATACCTACTAATGTAATGGTAACGCCTCCAGCTACACTATCCTTGTCAGGTGGCCAAGAATTGGAGCATGATA
CTACACCTAACTTACAGTTTATACCGGATTGGTTTCCGTCTTCGTTCAGCAAGAAAGAAGAGGATGGAGAAGTAGATATT
GGGGCAAGTGTGGACCAGTTTTTTGAATGTTTTGATGCAATGAGGAGTTACCAATCAGCTTCTGGAAGCCAAGGAATGTG
GAATTGGACATCTTCTGTTTTCACAGCAATAAATGCTGCATCTAGCCTTGCTTCGGGGTCTTTGCTTCTTCCTTCTGAAC
AACAACATGTTGAAACAAGTTGTAAAGTATCCTTTGCTGGAGTTTCGGTGGTATTATTTTTCCAAGATGAAGTCAATTGG
AAGGGTGTTTCAACGCGGATTCACTACTTGGGTGCCGAACTCAGAGATATTTCGGTCTCTTTTCAGGTATGCCTTCATGA
TCTGAGGTTAGAAGGAGAAGTGAACAGCATGGAGATCGCCGATTATTGTCAAGGTGGAAATGTTGTTGACACTGCTAATG
CTGAATCTCAGACTTGTTTGATTAAGGATTTACAAGCCAAAGTTCAGACTAGTCTTCCTCCCTTTGCCTCTTCTGATATG
CATTCTGACTCTGAAAGATTAAGCGAGATAGTTTCTGATGGATTCCTCTTTCGTAACAAGGGTTTCGCAGTCAAGACATT
GTTGGTTATAGCTGCAGGGGGCAGTGGATTTCAGTTTACTGTCAATTTCCAATCATCCAAAGCCAGCCATAGAGGATCAA
ACTCATTCTCATTGAGTTTACCCCCTACCACATTCTGGCTGAACCTTCATTCGGTAGAAATGTTGGTAAATCTTTTCAAC
GATGTATCAGAATCTATCCCCATAACCAGTCATGAAAGGAATCAGGTGGCATCCTCTTCTAAATCAGAAAGTTTGCGAGG
TAGTGTGTCAATCTGCAATGCTCGAGTGATTCTGTGGTTTCCTTTTGAGAGCATTTCAGAAAGGTTCTGCAACTCGCTTG
GTCAGCAATTTATCGTCGTCGATCTATCTTCCTCTCCGCCATCTGATAAGGAAAGGGCTAAGGAAAGAAGTCCAGGAGAA
ATGCACTTTCCATCAGCTACTCGCTCTATATGCTTCAGTGTTGGTGATGCTAGCATCTATTTGGTCACTTCTGACCTTAA
AGATTCTGAAACAAATTCATATCATAGGCAGGTTGAATTCTCTGCGTATAATATTTTACATACCAACAATAAAACTAGGC
ACCAACTTTCAACAATTGGCATGTTTTGGCAAGATAGACCTACCGTTAGCCCTTGGTTAGTGGAGAGAGCTAAGATGTTG
GCTACGCAGGAAGAATCTATTCAGACAGATAAATCTGGCGGGAGGGGCCTTGAGTTTGCTGCTGTTGCTACGCCCAAAGA
TCAAGACGACATCTACTCTCGAAGCAGGAAAGAAATAATTTTGGCTTCTTCGTTCTGCCTTTATGTTCATTTGCTTCCAC
TTGCTATCCATTTAGATAGTTGGCAATACAGCAAATTATGTAATCTAATAGAAGAGGCAAAAAATTGGCTATCGCGTATG
GCAGCCAATACAGCTGAGCAAACAGAGGAATCTGTTGTGTGTCAAACGTCTCTCGTTGTTGACTGTGATTCTATTGACAT
ATTGGTTAGGCCAGAACCTCGAATGGGCATAAAAAAACAGCTTCAGACTGAGCTCCCTGGATCATGGATTCAGTTCAACC
TGAGGGTTCAGAAATTAAATCTTATGTCTGTCCCAAATCTTGGCAGTGTCTCTGGTGCTGATTTCTTTTGGTTAGCCCAT
GGGGAAGGTACATTATTGGGTTCTGTTACAGGTCTACCTGATCAGGAACTGTTATTACTCTCATGTAACAACTCTGCCAT
CAAGCGTGGTAATGGAGGAGGTTCAAATGCGTTGTCGTCAAGGTTCGCTGGCTTAGATTTTCTGCACTTACAGGAACCAG
GAATTTGTAACGATTATTTAGCAGTATCTGCCAGGGGCTGTACGATCTCGGCCGTAGGAGGACGCCTGGATTGGATAGAA
GTGGCTACTTCTTTTTTCTCTTTTGAAGATGAAAAAAAAACTCAAGAGATCAACTCCAGCTCATCTAGCGGCTCCTCGTT
TATTCTGAATTTTGTTGATGTTGGTCTAAGCTATGAGCCCCACCATGAGAATACAGATCATTTACGTCAAGCAAGTGATC
CATGGGTTGCCTGTCTGGTAGCTGCATCTTCTTTTAGCCTTTCAAAGAAAAGTCTGGTTGATTCCATAAGAAATGATTAT
AGAATCAGGATTCAAGATCTTGGGCTTCTTCTGTCCGTGGATTTTGACCTTAGCAAGCTTGGTGGAACGTACAGTTCAGA
GCATCTTCATGAGTCTGGCTATGTTAAAGTTGCTAATGATTCGCTTATTGAAGCAATTCTAAGGACTAACTCTGAAAATG
GCCTTCTTTGGGAGTTAGAGTGTTCAAAATCTCACTTAGTAATTGAAACTTGCAGTGACACGACTTCTGGTTTGATTCGC
TTGGCCACCCAGCTCCAACAGTTACTTGCTCCTGATTTGGAGGAATCAGCTGTGCACTTGCAGACTCGATGGGACAGCAT
TCAACAGGCAAATGCTAGGAATGATTTAGATATCAGCGATAGACTCAGTAGCTCCGATTCAAGTGGAGAAATGAAATATT
TAAGATTAGAGTCAGAAAATGAAACTGGGGTCATTGGTTTGATGGACGAAATAAATGAAGATGCATTCCAATTTGATGTC
AATCCGACATATCAGTCTGACTCTGTGGAATGTCAGAATAACTATATGTCACCTCATGGAATCTCTCATGGGCAGGCATA
TAATTGGGTACCAGCTACTGAGAAACTACCTTCTAATCAAAGTATTTGTGGGTCGTCATCCAGAATAAACTCAGAAAGCA
GTCAAGTATTCCTAGAAAGAGAGAGCCTGCCTGAAATATTTGAAAACTATTGTTTGTCTGAGTTCCGTCCATCGTCAGAG
GTACCTCAAGAAGGGGATTCGTCGGGGAGAGAATTGTTTCCTGAGACTGATCTGAGGAGAGGAAATTCTGGGTGGTATGA
TGACGCGTCCTTAAGAATTGTAGAAGACCATGTGTCAGAAGCAACTGAGGAAGATCATGAGGAACACATTCTGGATGGAG
AATGTTCATCTTTTGGCCAGACGTCTTATTCTGCTGTAGCAGCTAATGGACGTATCCTTCTGAAAAACATTGACCTCAAA
TGGAGAATTTACTCTGGCTCTGACTGGCATGATTCTAGAAAGAAAGGTGAAAATTTTAAACATACAAAGGGCCGGGATAC
AACTTCGTGCCTTGAGCTGGAATTATCTGGGGTCCTTGGATATTACAACTCAAAAGATCACCCAAGAGACTCCTCTTCGT
ATGCATTCAAGTTGGAATTAAAAGCTGTCAGACCTGACCCTGAGACGCCACTCGAGGAAAACCGCTTCTTTGGAGCTAAC
AGCCTAGAAAAGCCTGTTGTTTCTATGGGAGACTCAGGTGGTTCAACGATGTCGGTTTCCGTACAAGGACATAATATCAT
AGAAGAAGCGCTTCTTCCATATTTTCAGAAATTCGACATATGGCCTGTTAATGTTCGAGTTGATTACAGTCCCCATCATG
TTGATATAGCAGCACTAACAGGAGGGAAATATGCAGAGCTTGTGAACCTTGTACCCTGGAAGGGGATTGAATTACAACTC
AAACATGTGCATGCTGCTGGAATCTATGGCTGGGGAAATGTATGTGAGACTATACTGGGAGAATGGTTGGAAGATGTATC
TCAGAATCAGATTCATCAACTTTTAAAGGGGATCCCAACAGTAAGATCACTTTCTGCTCTTTATGCTGCTGCTCTAAAGC
TGGTCTCGTCACCTGTTGAAAGTTACAGGAAAGATCGAAGGCTAGTGAAGGGAGTCCAAAGAGGGACTGTAGCGTTTCTC
AGAAGTATCTCACTGGAAGCTGTTGGACTCGGTGTTCACTTGGCAGCCGGGGCTCATGATATTTTATTGAGAGCAGAATA
TATATTTGCAAGTTCACCATCATTGCCACAACCCCAAGGCAGAACGAAGACGAATGTCAGACATAATCAGCCTAGAAATG
CTAAGCAAGGCATGCTTAAGGCATGTGAGAGCATCGGTGATGGAATAGGAAAGACAGCTTCTGCATTAGTCCGCACACCT
TTGAAGAAGTATCAACGTGGAGACGGAGCTGGATCAGCATTTGCAACTGTTGTTCAGGGAGTTCCAACAGCTGCTATAGC
ACCTGCTTCAGCTTGTGCTAGAGCTGTACATAGTGCTCTTGTTGGCATCAGAAATAGGTCGATTATTTCTCCTTTCAGTC
TTGATCCTGAACATAAAAAGGAATCCATGGAAAAATACTTAGGCCCCGACAAACAAAGGAAGCAGGACCAACACCGATAA