Details for Arabidopsis Locus AT3G19184

Position : Chr3 ( 5`- 6637443 .. 6639278 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19184

Protein [Map View]
MVESELSYEQIRLNRVEENKKRMGELNLNKLAQSLRVSSSSSSSSKPSPAKPRTMRIPVDFSEVRRSSRAKGPPPSYKEF
GLEPLERRPRRSSRRRDLLNRVYASDDARMYAFDRAEKLQSSLDSEYASFTKPMLQSHVTGGFWLGLPLPFCKAHMPKRD
VIMTLVDEEEEESQAKYLAQKNGLSGGWRGFAIDHQLVDGDAVVFHLIARTTFKVYIIRVNDDANNDSDGNEVNDDDSDG
NEEDRDNDNESNEKQKETVSEGRQLRSSGKRKRRGRK*

DNA
ATGGTGGAATCGGAGCTAAGCTATGAACAGATTCGTTTGAATAGGGTGGAAGAGAACAAGAAGAGAATGGGGGAGCTTAA
TCTCAACAAGCTTGCTCAATCTCTTCGTGTCTCTTCTTCTTCTTCTTCTTCTTCCAAGCCCTCACCAGCAAAGCCAAGAA
CGATGCGTATTCCAGTGGATTTCTCGGAGGTCAGGAGATCAAGCCGTGCCAAAGGTCCACCTCCAAGTTATAAAGAGTTT
GGGCTAGAACCACTGGAGAGGAGGCCAAGAAGGAGCTCTCGAAGAAGAGATTTGCTGAATCGGGTATATGCTTCGGACGA
CGCAAGAATGTACGCATTCGACAGGGCAGAGAAGCTCCAGTCAAGCTTAGATTCAGAATATGCAAGCTTTACCAAACCAA
TGCTCCAATCACACGTGACCGGAGGATTTTGGTTGGGTTTGCCGCTTCCTTTTTGCAAGGCACATATGCCAAAACGTGAT
GTAATAATGACTTTGGTTGACGAAGAAGAGGAGGAATCTCAGGCGAAATACCTTGCTCAGAAGAACGGTCTTAGTGGAGG
CTGGCGAGGTTTCGCCATTGATCACCAGTTAGTCGATGGAGATGCTGTAGTGTTTCACCTTATCGCTCGAACAACGTTCA
AGGTGTATATCATTAGGGTAAATGATGATGCAAACAATGATTCAGATGGGAATGAGGTAAATGATGATGATTCAGATGGG
AATGAAGAAGATCGAGATAATGATAATGAATCAAACGAGAAACAGAAGGAAACTGTTTCAGAAGGTAGACAGTTGAGAAG
CAGTGGTAAGAGGAAAAGACGAGGAAGAAAGTAG