Details for Arabidopsis Locus AT3G19180

Position : Chr3 ( 5`- 6632676 .. 6637224 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19180

Protein [Map View]
MPVAYTFPVLPSSCLLCGISNRSTSFVVDRPELQISGLLVVRSESGEFFGSGLSLRRFQREGRRRLNAAGGGIHVVDNAP
SRTSSLAASTSTIELPVTCYQLIGVSEQAEKDEVVKSVINLKKTDAEEGYTMEAAAARQDLLMDVRDKLLFESEYAGNLK
EKIAPKSPLRIPWAWLPGALCLLQEVGQEKLVLDIGRAALRNLDSKPYIHDIFLSMALAECAIAKAAFEVNKVSQGFEAL
ARAQSFLKSKVTLGKLALLTQIEESLEELAPPCTLDLLGLPRTPENAERRRGAIAALRELLRQGLSVEASCQIQDWPCFL
SQAISRLLATEIVDLLPWDDLAITRKNKKSLESHNQRVVIDFNCFYMVLLGHIAVGFSGKQNETINKAKTICECLIASEG
VDLKFEEAFCSFLLKQGSEAEALEKLKQLESNSDSAVRNSILGKESRSTSATPSLEAWLMESVLANFPDTRGCSPSLANF
FRAEKKYPENKKMGSPSIMNHKTNQRPLSTTQFVNSSQHLYTAVEQLTPTDLQSPVVSAKNNDETSASMPSVQLKRNLGV
HKNKIWDEWLSQSSLIGRVSVVALLGCTVFFSLKLSGIRSGRLQSMPISVSARPHSESDSFLWKTESGNFRKNLDSVNRN
GIVGNIKVLIDMLKMHCGEHPDALYLKSSGQSATSLSHSASELHKRPMDTEEAEELVRQWENVKAEALGPTHQVYSLSEV
LDESMLVQWQTLAQTAEAKSCYWRFVLLHLEVLQAHIFEDGIAGEAAEIEALLEEAAELVDESQPKNAKYYSTYKIRYIL
KKQEDGLWKFCQSDIQIQK*

DNA
ATGCCAGTAGCTTACACATTTCCAGTTCTCCCTTCTTCTTGTCTGCTTTGCGGAATCTCCAATCGCAGCACCAGCTTCGT
CGTAGATCGCCCGGAGCTTCAGATCTCAGGTCTCCTCGTCGTTCGTTCTGAATCCGGTGAATTCTTCGGTTCTGGTTTAT
CTTTGCGGCGGTTTCAGCGAGAAGGACGGAGGAGGTTGAATGCTGCTGGTGGTGGTATCCATGTCGTCGACAATGCGCCG
TCTCGTACTTCTTCTCTCGCTGCATCTACCTCTACAATCGAACTCCCGGTTACGTGTTACCAGCTTATCGGAGTTTCTGA
GCAAGCTGAGAAAGACGAGGTCGTTAAGTCGGTTATAAATTTGAAAAAAACTGATGCTGAAGAGGGTTATACAATGGAAG
CTGCTGCAGCTCGCCAGGATCTTCTCATGGATGTTAGGGATAAACTTCTTTTTGAATCAGAATATGCTGGTAACCTAAAA
GAAAAGATTGCTCCTAAATCTCCTCTCAGAATTCCGTGGGCATGGTTGCCTGGTGCTCTATGCCTTCTTCAAGAGGTTGG
ACAAGAAAAACTTGTGCTGGATATTGGCCGGGCTGCTCTCAGGAACCTTGATTCAAAGCCATATATTCATGATATATTCT
TATCTATGGCACTTGCTGAGTGTGCAATTGCCAAGGCTGCTTTCGAGGTTAACAAGGTCTCTCAAGGATTTGAAGCTCTT
GCTCGTGCTCAAAGTTTTCTGAAGAGTAAAGTTACTCTTGGGAAACTTGCATTGTTAACTCAGATTGAGGAGTCACTAGA
GGAGCTTGCACCACCTTGCACATTGGATCTACTGGGCCTGCCACGCACGCCAGAAAATGCAGAGAGGAGGCGAGGTGCAA
TTGCCGCGCTACGCGAACTGCTCAGACAGGGCCTTAGTGTTGAAGCTTCATGTCAAATTCAAGACTGGCCATGCTTTTTG
AGCCAGGCAATTAGCAGGTTATTGGCCACAGAGATTGTCGATCTTCTTCCATGGGATGATTTAGCCATTACACGGAAAAA
TAAAAAATCACTGGAATCCCACAATCAAAGAGTTGTTATTGATTTTAATTGTTTCTACATGGTGTTACTTGGTCACATCG
CTGTTGGATTTTCAGGCAAGCAAAATGAAACGATTAATAAAGCAAAAACGATATGCGAATGTCTCATAGCATCAGAAGGT
GTTGATCTGAAATTTGAGGAAGCTTTTTGCTCATTTCTTCTAAAACAGGGTTCCGAGGCAGAGGCCCTGGAAAAACTTAA
GCAGCTGGAATCAAATTCAGACTCTGCCGTTCGTAATTCGATCTTGGGGAAAGAGTCGAGAAGTACTTCTGCTACTCCCT
CACTGGAAGCGTGGCTAATGGAGTCCGTGCTTGCTAACTTTCCAGACACAAGGGGTTGTTCTCCATCTTTGGCCAATTTT
TTCCGGGCTGAAAAGAAATATCCAGAAAACAAGAAAATGGGGTCACCTTCGATCATGAATCATAAGACGAACCAAAGACC
ACTTTCCACAACACAGTTCGTGAACTCGTCACAACATCTTTATACAGCTGTCGAGCAGTTGACACCAACAGATTTGCAGA
GCCCAGTGGTATCAGCCAAGAATAATGATGAAACCAGTGCCAGTATGCCATCTGTTCAACTGAAGAGGAACCTTGGTGTA
CACAAAAATAAAATATGGGATGAGTGGCTCTCTCAAAGCAGTTTGATCGGAAGGGTATCTGTTGTTGCTTTACTGGGTTG
CACCGTGTTCTTCTCTCTGAAGCTATCAGGCATTAGGTCTGGTAGACTACAGAGTATGCCTATATCGGTTTCTGCTAGGC
CGCATTCAGAATCAGATTCTTTTCTGTGGAAAACAGAGTCTGGGAATTTCAGAAAAAACCTTGATTCTGTGAATAGAAAT
GGTATCGTGGGAAACATCAAAGTGCTCATTGACATGTTAAAGATGCATTGTGGCGAACATCCGGATGCCCTGTATCTGAA
AAGCTCTGGTCAATCAGCTACATCATTGTCTCATTCTGCGTCAGAACTGCATAAGAGACCAATGGATACAGAAGAAGCGG
AAGAGCTTGTGAGACAGTGGGAAAATGTTAAGGCTGAAGCTCTTGGACCAACACATCAAGTTTATAGCCTTTCCGAAGTC
CTTGATGAATCCATGCTTGTCCAGTGGCAAACATTGGCACAAACAGCAGAGGCGAAATCCTGTTATTGGAGGTTCGTTCT
GCTTCATCTTGAGGTTTTGCAAGCACATATATTCGAAGATGGTATTGCTGGTGAGGCTGCAGAAATCGAAGCTCTTCTGG
AGGAAGCAGCAGAATTAGTTGATGAATCTCAGCCCAAAAACGCAAAATATTATAGCACTTACAAGATCCGATATATTCTG
AAGAAGCAAGAAGATGGATTGTGGAAATTCTGCCAAAGCGATATTCAAATACAGAAGTGA