Details for Arabidopsis Locus AT3G19160

Position : Chr3 ( 5`- 6621988 .. 6623278 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19160

Protein [Map View]
MQNLTSTFVSPSMIPITSPRLRLPPPRSVVPMTTVCMEQSYKQKVVVIMGATGSGKSCLSIDLATRFSGEIVNSDKIQFY
DGLKVTTNQMSILERCGVPHHLLGELPPDDSELTTSEFRSLASRSISEITARGNLPIIAGGSNSFIHALLVDRFDPKTYP
FSSETSISSGLRYECCFLWVDVSVSVLFEYLSKRVDQMMESGMFEELAGFYDPRYSGSAIRAHGIHKTIGIPEFDRYFSL
YPPERKQKMSEWDQARKGAYDEAVQEIKENTWRLAKKQIERIMKLKSSGWDIQRLDATPSFGRSSREIWDNTVLDESIKV
VKRFLVKDKV*

DNA
ATGCAAAATCTTACGTCCACATTCGTCTCTCCTTCCATGATCCCGATCACTTCTCCGCGGCTGCGACTGCCACCACCACG
ATCAGTAGTTCCCATGACTACCGTTTGCATGGAACAATCATACAAGCAAAAAGTGGTTGTGATCATGGGAGCCACCGGAT
CAGGCAAGTCATGCCTCTCAATCGATCTAGCAACTCGTTTCTCTGGCGAGATCGTCAATTCCGACAAGATTCAATTCTAC
GATGGATTGAAGGTCACTACGAATCAAATGAGCATCCTTGAGAGATGTGGAGTCCCTCACCATCTCCTTGGTGAGCTCCC
TCCGGATGATAGCGAACTAACTACCTCCGAATTCCGCTCTTTGGCGTCGCGGTCCATCTCCGAGATTACTGCTCGTGGAA
ACCTCCCGATTATAGCTGGTGGATCAAACTCCTTCATTCATGCTCTCCTTGTCGACCGTTTTGACCCCAAAACCTATCCA
TTCTCTTCTGAGACATCCATCTCTTCCGGCTTGAGGTACGAGTGTTGCTTCCTTTGGGTGGATGTCTCAGTGTCGGTCCT
GTTCGAGTACCTCTCGAAACGTGTCGACCAGATGATGGAGTCAGGGATGTTCGAGGAGCTAGCCGGTTTCTACGACCCGA
GATATTCCGGGTCCGCAATCCGAGCCCACGGGATTCACAAGACCATAGGAATACCCGAGTTCGACCGGTACTTCAGCTTA
TACCCGCCTGAGAGAAAGCAGAAGATGTCCGAATGGGACCAAGCAAGAAAGGGGGCGTATGACGAAGCTGTCCAAGAGAT
CAAAGAGAACACATGGAGGCTTGCGAAGAAGCAGATTGAGAGGATCATGAAGCTGAAAAGCAGCGGATGGGACATTCAGA
GGTTGGACGCTACGCCGTCATTTGGAAGATCGTCAAGAGAGATTTGGGACAATACTGTTTTGGATGAAAGCATCAAGGTT
GTGAAACGCTTCTTGGTGAAAGACAAAGTGTGA