Details for Arabidopsis Locus AT3G19130

Position : Chr3 ( 5`- 6611198 .. 6614044 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19130

Protein [Map View]
MQTTNGSDSTLATSGATPPNQQTPPPPQQWQQQQQQQQQWMAAMQYPPAAAMMMMQQQQMLMYPHQYVPYNQGPYQQHHP
QLHQYGSYQQHQHQQHKAIDRGSGDDVKTLWVGDLLHWMDETYLHSCFSHTGEVSSVKVIRNKLTSQSEGYGFVEFLSRA
AAEEVLQNYSGSVMPNSDQPFRINWASFSTGEKRAVENGPDLSVFVGDLSPDVTDVLLHETFSDRYPSVKSAKVVIDSNT
GRSKGYGFVRFGDENERSRALTEMNGAYCSNRQMRVGIATPKRAIANQQQHSSQAVILAGGHGSNGSMGYGSQSDGESTN
ATIFVGGIDPDVIDEDLRQPFSQFGEVVSVKIPVGKGCGFVQFADRKSAEDAIESLNGTVIGKNTVRLSWGRSPNKQWRG
DSGQQWNGGYSRGHGYNNGGGYANHHDSNNYHGEN*

DNA
ATGCAGACAACCAACGGCTCAGATTCGACGTTGGCAACTTCCGGAGCCACACCGCCGAATCAACAAACCCCTCCTCCACC
TCAGCAGTGGCAGCAGCAGCAACAGCAACAGCAACAGTGGATGGCTGCCATGCAATATCCACCAGCGGCGGCGATGATGA
TGATGCAGCAGCAACAGATGCTGATGTATCCTCATCAATATGTTCCGTATAATCAAGGTCCTTATCAGCAGCATCATCCT
CAGCTTCACCAATACGGGTCTTATCAACAGCACCAGCACCAGCAACACAAGGCTATTGACCGTGGATCTGGAGATGATGT
CAAGACTCTTTGGGTTGGTGATCTTCTTCATTGGATGGATGAGACTTATCTCCATTCTTGCTTTTCTCACACCGGCGAGG
TTTCTTCTGTGAAAGTTATACGTAACAAGCTCACTTCTCAATCAGAAGGGTATGGGTTTGTTGAGTTTCTTTCACGTGCT
GCAGCTGAAGAAGTTCTTCAGAACTATAGTGGTTCAGTGATGCCAAACTCGGACCAACCCTTCCGTATAAACTGGGCATC
TTTTAGTACTGGTGAAAAAAGAGCAGTGGAAAATGGTCCAGACCTATCTGTTTTTGTGGGAGACTTGTCTCCAGATGTCA
CTGACGTTTTATTGCATGAGACCTTTTCTGATAGATATCCTTCTGTCAAAAGCGCCAAAGTTGTGATTGATTCCAACACC
GGCCGGTCCAAAGGTTATGGTTTTGTGAGGTTCGGTGATGAAAATGAGAGGTCAAGGGCTTTGACAGAAATGAATGGAGC
TTACTGTTCGAACAGGCAAATGCGTGTAGGTATTGCAACTCCCAAAAGAGCGATTGCTAATCAGCAACAACATTCTTCAC
AAGCTGTGATTCTGGCTGGTGGACATGGATCAAATGGTTCCATGGGTTATGGCTCGCAGTCTGATGGCGAATCAACTAAC
GCAACAATATTTGTTGGCGGCATTGACCCTGATGTTATTGATGAAGACCTCAGACAACCTTTTTCCCAGTTTGGAGAGGT
TGTTTCAGTGAAGATCCCAGTAGGGAAAGGATGTGGATTTGTCCAATTTGCTGACAGGAAGAGTGCTGAAGATGCTATCG
AGAGTTTGAACGGGACAGTCATCGGCAAGAACACTGTCAGACTCTCCTGGGGACGAAGCCCAAACAAGCAGTGGAGAGGA
GACTCAGGGCAGCAGTGGAATGGAGGATACTCACGAGGACATGGTTACAACAATGGAGGAGGATATGCTAACCACCACGA
CTCCAACAACTATCATGGGGAGAATTGA