Details for Arabidopsis Locus AT3G19085

Position : Chr3 ( 5`- 6599589 .. 6600584 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19085

Protein [Map View]
MEKLIAGCPVLEDFALILPDDERHKAMPSLRVRSQTLKSFLFAFEFNTTGKAFAVEIDAPALKCMTFSDSQSDKIVLKNL
NSLSMVDINSDFHLKYGKTLGPRKRNVIRDFLIGISSVRHMIISKLTLEVLFRYSKLGRKFPKFDNLTRLEATLSRSMLE
LFPSFLESFPNLKNLI*

DNA
ATGGAGAAACTCATCGCAGGTTGTCCTGTTCTTGAAGACTTTGCCTTAATTCTGCCTGATGATGAGCGCCACAAAGCTAT
GCCTTCTCTGCGTGTGAGGTCTCAGACTTTAAAGAGCTTTCTGTTCGCGTTTGAGTTTAATACCACTGGTAAAGCTTTTG
CAGTTGAGATTGATGCTCCAGCACTCAAGTGTATGACTTTCAGTGATAGTCAATCTGATAAGATTGTGTTGAAGAATCTG
AATTCTCTTTCCATGGTCGATATCAATAGTGACTTTCATCTTAAGTATGGGAAAACTTTGGGTCCAAGAAAGAGAAACGT
TATCCGCGATTTTCTCATTGGTATCTCTAGTGTGAGACATATGATCATCTCTAAGCTTACTCTAGAGGTCCTCTTTCGAT
ATTCCAAATTGGGACGGAAATTTCCCAAATTTGATAACTTGACTCGTTTGGAAGCTACACTCTCTAGATCCATGTTAGAA
CTATTTCCATCCTTTCTTGAGAGCTTCCCGAACCTGAAAAATCTCATATAG