Details for Arabidopsis Locus AT3G19030

Position : Chr3 ( 5`- 6563979 .. 6564424 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19030

Protein [Map View]
MVSQKLEICIELVKIAVVFVTTVAESVEEAFRKPPPSLPAVHGGRRNNYAAVPIPLVGFM*

DNA
ATGGTGTCTCAAAAGCTAGAGATTTGCATCGAATTGGTGAAAATTGCTGTTGTTTTCGTCACCACCGTGGCTGAATCAGT
AGAAGAAGCTTTCCGTAAGCCTCCACCGTCTCTTCCAGCAGTTCACGGTGGTCGCCGGAATAATTACGCCGCCGTTCCCA
TTCCTCTTGTTGGATTCATGTGA