Details for Arabidopsis Locus AT3G19000

Position : Chr3 ( 5`- 6553529 .. 6555147 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G19000

Protein [Map View]
MGELDEAFIQAPEHRPNTHLTNSGDFIFSDEIPTIDLSSLEDTHHDKTAIAKEIAEACKRWGFFQVINHGLPSALRHRVE
KTAAEFFNLTTEEKRKVKRDEVNPMGYHDEEHTKNVRDWKEIFDFFLQDSTIVPASPEPEDTELRKLTNQWPQNPSHFRE
VCQEYAREVEKLAFRLLELVSISLGLPGDRLTGFFNEQTSFLRFNHYPPCPNPELALGVGRHKDGGALTVLAQDSVGGLQ
VSRRSDGQWIPVKPISDALIINMGNCIQVWTNDEYWSAEHRVVVNTSKERFSIPFFFFPSHEANIEPLEELISEENPPCY
KKYNWGKFFVSRNRSDFKKLEVENIQIDHFKA*

DNA
ATGGGAGAACTCGACGAAGCTTTTATCCAAGCTCCAGAACACAGACCCAACACTCACCTCACAAACTCCGGTGATTTCAT
TTTCTCCGACGAGATCCCGACCATCGACCTCTCTTCTCTCGAAGATACTCATCATGACAAGACTGCGATCGCCAAGGAGA
TTGCAGAGGCATGCAAGAGATGGGGATTTTTTCAAGTGATCAACCATGGCTTGCCTTCAGCTTTAAGGCATCGTGTAGAG
AAGACAGCTGCTGAGTTTTTCAATCTAACGACGGAGGAGAAGAGGAAAGTGAAAAGAGACGAAGTGAATCCTATGGGTTA
TCACGACGAAGAACACACTAAGAACGTTAGAGATTGGAAGGAAATTTTCGATTTCTTCTTACAAGATTCCACGATCGTTC
CGGCGTCACCGGAGCCGGAAGATACTGAGCTCCGAAAGCTCACGAACCAGTGGCCTCAAAACCCTTCTCATTTCAGAGAG
GTATGCCAAGAATATGCAAGAGAAGTTGAGAAGTTAGCTTTTAGGCTATTGGAACTTGTCTCCATTAGTTTGGGTCTACC
TGGTGATCGGCTAACCGGTTTCTTCAATGAGCAAACTAGTTTTTTGCGGTTTAACCATTACCCTCCTTGCCCGAACCCCG
AGCTAGCATTAGGTGTTGGACGTCACAAAGATGGAGGAGCTTTAACCGTCCTGGCCCAAGATAGTGTAGGTGGATTACAA
GTGAGTCGTAGATCGGATGGACAATGGATCCCCGTGAAACCGATCTCGGATGCTTTGATCATTAACATGGGCAATTGTAT
TCAGGTGTGGACAAATGATGAGTATTGGAGTGCTGAACATAGAGTGGTCGTGAATACAAGCAAAGAGAGATTCTCAATAC
CATTCTTCTTCTTCCCATCACATGAAGCCAATATTGAGCCATTGGAGGAGCTTATAAGTGAGGAAAACCCGCCTTGTTAT
AAAAAGTACAATTGGGGAAAGTTCTTTGTTTCAAGAAACAGAAGTGATTTCAAGAAACTCGAGGTTGAGAATATCCAGAT
TGATCACTTCAAGGCTTAG