Details for Arabidopsis Locus AT3G18990

Position : Chr3 ( 5`- 6548869 .. 6551853 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18990

Protein [Map View]
MPRPFFHKLIFSSTIQEKRLRVPDKFVSKFKDELSVAVALTVPDGHVWRVGLRKADNKIWFQDGWQEFVDRYSIRIGYLL
IFRYEGNSAFSVYIFNLSHSEINYHSTGLMDSAHNHFKRARLFEDLEDEDAEVIFPSSVYPSPLPESTVPANKGYASSAI
QTLFTGPVKAEEPTPTPKIPKKRGRKKKNADPEEINSSAPRDDDPENRSKFYESASARKRTVTAEERERAINAAKTFEPT
NPFFRVVLRPSYLYRGCIMYLPSGFAEKYLSGISGFIKVQLAEKQWPVRCLYKAGRAKFSQGWYEFTLENNLGEGDVCVF
ELLRTRDFVLKVTAFRVNEYV*

DNA
ATGCCACGCCCTTTCTTCCATAAGTTGATTTTCTCATCCACTATCCAAGAAAAACGTCTGAGGGTCCCAGATAAGTTTGT
GAGTAAATTCAAGGATGAGCTTTCGGTTGCTGTTGCACTCACAGTACCTGATGGTCATGTTTGGCGTGTAGGACTAAGGA
AAGCTGACAACAAAATTTGGTTTCAAGATGGTTGGCAAGAGTTTGTTGACCGTTACTCCATTCGCATTGGTTATCTTTTG
ATTTTTAGATATGAAGGAAACTCTGCCTTCAGCGTCTACATTTTCAATTTATCCCACTCTGAGATCAATTACCATTCCAC
CGGTCTCATGGATTCCGCTCACAACCACTTCAAACGCGCCCGTTTGTTTGAAGACCTTGAAGATGAAGATGCCGAGGTCA
TCTTTCCTTCTTCTGTGTACCCATCACCACTTCCTGAGTCTACAGTACCAGCCAACAAAGGGTATGCTAGTTCAGCCATC
CAAACCTTGTTCACTGGACCAGTTAAAGCTGAAGAGCCAACGCCAACCCCAAAAATACCTAAAAAGAGAGGGAGGAAGAA
GAAAAATGCTGATCCTGAGGAAATAAACTCATCAGCTCCGCGAGATGATGATCCAGAGAACCGTTCAAAGTTCTACGAGA
GTGCTTCTGCGAGAAAGAGAACCGTGACTGCAGAAGAAAGAGAGAGAGCCATCAATGCAGCCAAAACGTTCGAACCAACA
AACCCTTTCTTCAGAGTGGTTCTGCGACCATCCTATCTATACAGAGGTTGCATCATGTATCTTCCTTCTGGGTTTGCTGA
GAAGTACCTAAGTGGGATCTCCGGGTTCATCAAAGTCCAGCTTGCGGAGAAACAATGGCCTGTTCGATGTCTCTACAAAG
CCGGGAGAGCCAAATTCAGTCAAGGATGGTACGAATTCACTCTAGAGAACAACTTAGGAGAAGGAGACGTCTGTGTGTTT
GAGCTGCTCAGAACCAGAGATTTCGTTTTGAAAGTGACAGCCTTTCGAGTCAACGAGTACGTCTGA