Details for Arabidopsis Locus AT3G18930

Position : Chr3 ( 5`- 6523379 .. 6525543 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18930

Protein [Map View]
MRFVAPPPRSGDNSPSPSPSSGISEEILSRSSDPPLEFSPPLIAMVVVLAAAFLFVTYSRLISRRFLSPLFRRFRRWRCR
RRRLLHLSSASSASTSSSDLRSFSPFPFDSFHYSSYSPYGLDDSVIKTLPLFLYSAAACTGKPAVGKTSAANCRDCAVCL
LEFEEGDYVRTLPLCFHAFHLECIDEWLRSHPNCPLCRTAILGSAGVLTPMSPFVPLMAPRIRPSLDDEENNAIIIRGEI
TPSRSNWNTIAADTTNDQEIRASVEEQSSPAISRFRELKRSYSFECERESESERVTMEPATVSPWRYRRSTWNKRQSPFG
NLISKSRVFSFRYYRSTKSPFFRRRSSAGVFYPISERIPATGSSSRRTKSMTSPMFFRTAPHSSSRLRCGDPEALLSPER
WRRRDTCRAEM*

DNA
ATGCGATTCGTCGCGCCACCGCCTCGTTCCGGCGATAACTCACCGTCACCTTCACCATCTTCCGGTATATCCGAAGAGAT
TCTCTCCCGTTCTTCGGATCCTCCTTTAGAGTTTAGTCCTCCATTGATCGCCATGGTGGTGGTTCTAGCCGCCGCTTTTC
TATTCGTAACTTACTCTCGTCTCATCTCCCGCCGTTTTCTTTCACCTCTATTCCGTCGTTTTAGAAGGTGGCGATGCCGT
CGACGCCGTCTCCTTCACTTATCTTCAGCTTCCTCTGCTTCAACTTCATCCTCCGATCTCCGATCATTTTCACCTTTCCC
TTTCGACTCTTTTCATTACTCTTCTTACTCACCTTACGGATTAGACGATTCCGTTATCAAAACTTTACCGCTGTTTCTCT
ACTCCGCCGCTGCTTGCACCGGAAAACCCGCGGTGGGGAAAACCTCCGCCGCCAATTGCAGAGATTGTGCTGTTTGTTTG
TTGGAATTCGAAGAAGGTGATTATGTACGAACACTTCCGTTATGCTTCCATGCTTTTCACCTTGAATGCATCGATGAATG
GCTCCGATCTCACCCTAACTGTCCGTTATGCCGTACGGCGATTCTCGGATCCGCCGGAGTTTTAACGCCTATGTCGCCGT
TCGTTCCGTTAATGGCTCCTCGAATTCGTCCGAGTCTCGATGATGAAGAGAATAACGCGATCATCATCCGCGGCGAAATC
ACACCGTCGCGGAGCAATTGGAACACAATCGCTGCCGATACGACGAACGATCAGGAGATCAGAGCGTCGGTGGAAGAGCA
ATCATCACCGGCGATTTCTCGGTTCCGGGAGCTGAAGAGATCGTACTCGTTCGAATGCGAGAGAGAATCTGAATCAGAGA
GAGTAACGATGGAGCCAGCGACGGTGTCTCCATGGAGATACCGGAGATCTACATGGAACAAACGTCAATCACCGTTCGGA
AACCTAATATCGAAATCAAGAGTGTTCTCGTTCCGTTACTACAGAAGCACGAAATCACCGTTCTTCCGACGGAGATCATC
GGCGGGAGTGTTTTACCCGATATCAGAACGGATTCCAGCGACGGGAAGCTCATCGCGGCGAACGAAATCGATGACGAGTC
CGATGTTCTTCAGAACAGCACCGCACTCATCGAGCCGGTTAAGATGCGGAGATCCAGAGGCACTGTTATCGCCGGAGAGA
TGGAGAAGAAGAGACACGTGTAGGGCAGAGATGTAA