Details for Arabidopsis Locus AT3G18890

Position : Chr3 ( 5`- 6511023 .. 6514994 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18890

Protein [Map View]
MEGTCFLRGQPLTTIPSLPSRKGFLLQRWKTNRIVRFSGFKNHSVSGKSRSFDLSLRASGPIRASSVVTEASPTNLNSKE
EDLVFVAGATGKVGSRTVRELLKLGFRVRAGVRSAQRAGSLVQSVKEMKLQNTDEGTQPVEKLEIVECDLEKKDSIQPAL
GNASVIICCIGASEKEISDITGPYRIDYLATKNLVDAATSAKVNNFILVTSLGTNKFGFPAAILNLFWGVLCWKRKAEEA
LIESGLNYAIVRPGGMERPTDAYKETHNLTLALDDTLFGGQVSNLQVAELLACMAKNPQLSFSKIVEVVAETTAPLTPIE
KLLEKIPSKRPYVPPPKASVATKEVKPVPTKPVTQEPTAPKEDEAPPKEKNVKPRPLSPYASYEDLKPPTSPIPNSTTSV
SPAKSKEVDATQVPVEANVVPVPDSTSNVPVVEVKQVEEKKERPLSPYARYENLKPPSSPSPTASSTRKSDSLSPGPTDS
DTDKSSTVAKTVTETAVATSVTETSVATSVPETAVATSVTETAAPATSKMRPLSPYAIYADLKPPTSPTPASTGPKEAAS
VEDNSELPGGNNDVLKTVDGNLNTIPPSTPEAVPVVSSAIDTSLASGDNTAQPKPRPLSPYTMYADMKPPTSPLPSPVTN
H*

DNA
ATGGAAGGAACTTGTTTTCTCCGTGGACAACCTCTCACAACAATACCCTCTCTTCCCAGCAGAAAAGGGTTTCTTCTCCA
AAGATGGAAGACCAATCGGATTGTCAGGTTTTCAGGTTTTAAGAATCACTCGGTTTCTGGAAAGTCGAGGTCTTTCGATC
TTAGCCTCAGAGCTTCAGGTCCCATTAGAGCAAGCTCTGTAGTAACAGAAGCAAGCCCTACCAACTTAAATTCCAAAGAA
GAAGACCTTGTCTTTGTAGCCGGTGCTACTGGTAAAGTTGGTTCTAGAACTGTGAGAGAGCTACTGAAGCTGGGATTTCG
GGTTAGAGCTGGAGTTCGAAGTGCTCAGAGAGCAGGAAGTCTTGTGCAAAGTGTTAAGGAAATGAAGCTCCAGAACACAG
ATGAAGGAACTCAACCTGTAGAAAAGCTTGAAATTGTGGAGTGTGACTTGGAGAAGAAAGATTCAATACAGCCCGCATTG
GGAAATGCATCGGTGATTATATGCTGTATTGGTGCTAGCGAGAAAGAGATCTCCGATATTACCGGTCCTTACAGGATCGA
TTACCTAGCCACCAAAAACCTTGTTGATGCTGCAACATCAGCAAAAGTTAATAACTTCATTTTGGTGACATCCTTGGGGA
CAAATAAATTTGGATTTCCCGCTGCGATTCTCAACCTATTCTGGGGAGTTCTTTGCTGGAAGAGAAAAGCTGAAGAAGCA
TTGATTGAAAGCGGTCTTAATTACGCAATAGTTAGACCTGGAGGAATGGAGAGACCGACTGATGCATACAAAGAAACTCA
TAATCTCACTCTTGCTCTAGACGATACATTGTTTGGTGGTCAGGTCTCAAATCTCCAGGTTGCAGAGTTGCTTGCTTGCA
TGGCAAAGAATCCTCAACTTTCTTTCTCTAAGATTGTGGAAGTGGTTGCTGAAACAACTGCACCATTAACTCCAATTGAA
AAGCTTCTTGAAAAGATTCCTTCCAAACGGCCTTATGTCCCTCCACCGAAGGCATCAGTTGCAACCAAAGAGGTCAAACC
AGTCCCTACTAAGCCTGTCACTCAAGAACCAACAGCTCCTAAAGAGGATGAAGCACCTCCAAAAGAAAAAAATGTGAAAC
CTAGGCCGCTGTCTCCTTATGCCTCCTACGAAGACTTGAAACCTCCAACATCTCCTATTCCAAATTCGACCACATCGGTC
AGTCCTGCCAAATCTAAGGAGGTAGATGCCACTCAGGTTCCTGTTGAGGCCAATGTAGTGCCAGTGCCAGATAGTACCTC
AAATGTCCCAGTAGTAGAAGTAAAGCAAGTTGAGGAAAAGAAAGAGAGGCCTCTTTCCCCTTATGCCCGCTATGAGAACC
TAAAACCACCCTCATCGCCCTCTCCTACAGCTTCGAGTACCAGAAAGAGTGATTCTTTGTCGCCTGGTCCAACCGATTCT
GATACTGATAAAAGCTCAACAGTTGCAAAAACTGTCACTGAGACGGCAGTTGCAACAAGTGTCACTGAGACCTCAGTTGC
AACAAGTGTACCTGAGACAGCAGTTGCAACGAGTGTCACTGAGACAGCAGCACCAGCCACATCAAAAATGAGGCCTCTTT
CTCCTTATGCAATTTACGCAGACCTGAAACCACCAACCTCACCAACTCCTGCATCAACAGGTCCCAAGGAAGCAGCATCT
GTAGAAGACAACTCAGAGTTACCTGGAGGCAATAATGATGTGCTGAAAACAGTTGATGGAAATCTGAACACAATTCCACC
TTCTACACCGGAAGCAGTACCTGTTGTTAGCAGTGCGATAGACACTTCCCTTGCTTCAGGAGACAATACAGCTCAGCCAA
AGCCAAGGCCTTTATCACCTTACACAATGTACGCGGACATGAAGCCTCCAACATCACCACTTCCATCTCCAGTCACCAAT
CATTAG