Details for Arabidopsis Locus AT3G18880

Position : Chr3 ( 5`- 6509540 .. 6510625 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18880

Protein [Map View]
MKAVIGTVVSNKMQMSVVVAVDRLFHNNIYNRYVKRTSKFMAHDEKDSCNIGDRVKLDPSRPLSKHKHWIVSEIIKKARI
YSPQAAAAALNSSTSIAEQPPVSSS*

DNA
ATGAAGGCAGTGATAGGGACAGTGGTGTCGAACAAAATGCAGATGTCGGTGGTGGTAGCCGTCGACAGACTCTTCCACAA
TAATATCTACAATCGATATGTCAAGCGTACTTCCAAGTTCATGGCTCACGATGAAAAGGACTCCTGTAACATCGGCGATC
GAGTGAAATTGGATCCTTCAAGGCCTTTGAGCAAGCATAAGCATTGGATTGTTTCAGAAATCATAAAGAAAGCACGCATT
TATTCTCCACAAGCTGCTGCTGCGGCTCTCAATTCCTCAACCTCCATTGCTGAGCAGCCCCCTGTTTCGTCTTCCTAA