Details for Arabidopsis Locus AT3G18850

Position : Chr3 ( 5`- 6499415 .. 6501359 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18850

Protein [Map View]
MEKKSVPNSDKLSLIRVLRGIICLMVLVSTAFMMLIFWGFLSAVVLRLFSIRYSRKCVSFFFGSWLALWPFLFEKINKTK
VIFSGDKVPCEDRVLLIANHRTEVDWMYFWDLALRKGQIGNIKYVLKSSLMKLPLFGWAFHLFEFIPVERRWEVDEANLR
QIVSSFKDPRDALWLALFPEGTDYTEAKCQRSKKFAAENGLPILNNVLLPRTKGFVSCLQELSCSLDAVYDVTIGYKTRC
PSFLDNVYGIEPSEVHIHIRRINLTQIPNQEKDINAWLMNTFQLKDQLLNDFYSNGHFPNEGTEKEFNTKKYLINCLAVI
AFTTICTHLTFFSSMIWFRIYVSLACVYLTSATHFNLRSVPLVETAKNSLKLVNK*

DNA
ATGGAAAAAAAGAGTGTACCAAATTCTGATAAGTTGTCTCTGATTAGAGTGTTAAGAGGTATAATATGTCTGATGGTGTT
AGTTTCAACAGCTTTTATGATGTTGATATTCTGGGGGTTCTTATCAGCTGTAGTGTTGAGGCTTTTCAGCATTCGCTATA
GCCGTAAATGTGTTTCCTTCTTCTTTGGCTCGTGGCTCGCCTTGTGGCCTTTCCTCTTTGAGAAGATTAACAAAACCAAA
GTTATCTTCTCTGGTGATAAGGTTCCTTGCGAGGATCGAGTATTGCTCATTGCAAACCACCGAACAGAAGTTGATTGGAT
GTACTTCTGGGATCTTGCACTGCGTAAAGGCCAGATTGGGAATATCAAATATGTGCTTAAGAGTAGTTTGATGAAATTAC
CTCTCTTTGGTTGGGCGTTTCACCTCTTTGAGTTTATTCCAGTTGAGAGGAGATGGGAAGTCGATGAAGCAAACTTGAGA
CAGATAGTTTCGAGTTTTAAGGATCCCCGAGACGCTTTATGGCTTGCTCTTTTCCCCGAGGGCACAGATTACACAGAGGC
TAAATGCCAAAGGAGTAAGAAATTTGCTGCTGAAAATGGCCTTCCGATACTGAACAACGTGCTGCTTCCCAGGACAAAAG
GTTTCGTCTCCTGCTTGCAAGAACTGAGTTGCTCACTTGACGCAGTTTATGATGTGACCATCGGTTATAAAACCCGCTGC
CCATCTTTCTTAGACAACGTTTATGGAATTGAGCCATCAGAAGTTCACATCCACATCCGTCGTATCAACCTGACCCAAAT
CCCAAATCAAGAAAAGGACATCAATGCTTGGTTAATGAACACATTCCAGCTCAAAGACCAGCTGCTCAATGACTTTTACT
CCAATGGTCATTTCCCTAACGAAGGAACAGAGAAAGAGTTCAACACAAAGAAGTACCTCATAAACTGTTTGGCAGTGATT
GCCTTCACCACCATCTGTACACATCTCACCTTCTTCTCATCAATGATTTGGTTCAGGATTTATGTCTCTTTGGCCTGTGT
CTACTTGACCTCTGCTACGCATTTCAATCTTCGTTCTGTTCCACTTGTTGAGACTGCAAAAAATTCCCTCAAATTAGTAA
ACAAATAA