Details for Arabidopsis Locus AT3G18830

Position : Chr3 ( 5`- 6488862 .. 6491273 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18830

Protein [Map View]
MTGATPENRTAPSPPPVKHVPESVLPAKPPKRNNYAFACAILASMTSILLGYDIGVMSGAMIYIKRDLKINDLQIGILAG
SLNIYSLIGSCAAGRTSDWIGRRYTIVLAGAIFFAGAILMGLSPNYAFLMFGRFIAGIGVGYALMIAPVYTAEVSPASSR
GFLNSFPEVFINAGIMLGYVSNLAFSNLPLKVGWRLMLGIGAVPSVILAIGVLAMPESPRWLVMQGRLGDAKRVLDKTSD
SPTEATLRLEDIKHAAGIPADCHDDVVQVSRRNSHGEGVWRELLIRPTPAVRRVMIAAIGIHFFQQASGIDAVVLFSPRI
FKTAGLKTDHQQLLATVAVGVVKTSFILVATFLLDRIGRRPLLLTSVGGMVLSLAALGTSLTIIDQSEKKVMWAVVVAIA
TVMTYVATFSIGAGPITWVYSSEIFPLRLRSQGSSMGVVVNRVTSGVISISFLPMSKAMTTGGAFYLFGGIATVAWVFFY
TFLPETQGRMLEDMDELFSGFRWRDSKSKPKGNPEKTVPNPEVEIGSNKQWKEGDTQSS*

DNA
ATGACAGGTGCCACACCGGAAAACCGAACGGCCCCGTCGCCACCACCGGTGAAACATGTGCCGGAGTCAGTTCTGCCGGC
TAAACCACCAAAGAGGAACAATTATGCATTCGCGTGTGCTATCTTAGCTTCCATGACTTCTATCCTCCTTGGTTATGATA
TAGGAGTGATGAGTGGAGCAATGATTTATATAAAGAGAGATTTGAAGATTAATGATTTACAAATCGGGATTCTCGCTGGA
AGCCTCAACATCTATTCACTTATAGGATCTTGCGCCGCCGGAAGAACCTCTGACTGGATTGGTCGGCGTTACACTATCGT
GTTGGCTGGAGCCATATTCTTCGCCGGAGCTATCCTTATGGGATTGTCCCCTAACTACGCTTTCCTCATGTTCGGAAGGT
TCATCGCCGGTATCGGCGTCGGATATGCTCTCATGATCGCACCAGTTTATACCGCCGAAGTCTCTCCGGCATCTTCCCGC
GGCTTCCTCAATTCCTTCCCCGAGGTGTTTATCAACGCCGGAATTATGCTCGGGTACGTATCAAATCTGGCTTTCTCGAA
CTTGCCGTTGAAGGTAGGATGGAGACTGATGCTCGGAATCGGAGCCGTACCTTCCGTGATACTCGCTATCGGCGTTCTCG
CTATGCCGGAATCTCCACGGTGGCTCGTTATGCAAGGCCGTCTCGGTGATGCCAAGCGCGTTCTGGACAAAACCTCTGAT
TCCCCCACCGAAGCAACTCTCCGTCTCGAAGACATCAAACACGCCGCTGGTATTCCCGCCGATTGCCACGACGACGTCGT
TCAGGTGTCGAGGAGGAACAGTCATGGAGAAGGAGTTTGGAGAGAGCTTTTAATCCGACCAACACCAGCCGTGCGTCGTG
TTATGATCGCCGCAATCGGAATCCATTTCTTCCAGCAAGCTTCCGGTATCGACGCGGTGGTTCTCTTCTCACCGCGAATT
TTCAAAACCGCCGGACTCAAAACCGATCACCAACAGCTTCTAGCGACTGTAGCAGTAGGAGTAGTGAAGACATCATTCAT
ACTAGTCGCCACTTTCTTACTCGACAGAATCGGGAGAAGACCATTGCTTCTAACCAGCGTAGGAGGAATGGTACTATCTC
TAGCAGCGTTAGGGACTTCTCTAACGATTATAGACCAGTCAGAGAAGAAAGTGATGTGGGCTGTGGTTGTAGCTATAGCT
ACGGTGATGACTTATGTAGCTACGTTTTCGATAGGAGCTGGACCGATAACTTGGGTTTATAGCTCGGAGATATTCCCGTT
GAGGTTGAGATCACAGGGCTCGAGTATGGGTGTGGTGGTGAACAGAGTGACTAGTGGTGTGATCTCGATATCGTTTCTTC
CAATGTCGAAAGCGATGACTACTGGTGGAGCGTTTTACTTGTTTGGAGGGATTGCGACTGTGGCTTGGGTTTTCTTTTAC
ACTTTCTTGCCGGAGACGCAAGGGAGGATGCTTGAGGATATGGATGAGCTTTTCAGTGGTTTCAGGTGGAGAGATTCCAA
GAGTAAGCCTAAGGGTAACCCCGAGAAGACGGTACCGAATCCCGAGGTTGAGATTGGATCAAACAAGCAGTGGAAGGAAG
GAGACACACAAAGTTCGTAG