Details for Arabidopsis Locus AT3G18800

Position : Chr3 ( 5`- 6479688 .. 6480378 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18800

Protein [Map View]
MADYDDEIDQNNQPFIPKETALQALNSIIQLHFEKTLEKKRAIDHQKKKLHKLFQLFFIFLAVIFFSLSQPSGRLHCRHC
WAPICLLSFSHLFFYVSVAQTLRCINGFKYQRRCHKLTLGLATHKLRFIKSRIAAGDFLGGGDGDEASAAAWDLEVPYQE
PPDSYFGKFKRNWALYFGFLILLYTFMISFSVVILCF*

DNA
ATGGCGGACTACGACGACGAAATTGACCAGAATAACCAACCTTTCATCCCCAAAGAAACTGCTCTACAAGCACTAAACTC
AATAATCCAGCTCCACTTCGAGAAAACCTTAGAGAAGAAACGAGCCATTGACCACCAGAAGAAGAAGCTCCACAAGCTAT
TTCAGCTCTTCTTCATCTTCCTCGCCGTAATCTTCTTCTCCCTCTCTCAACCCTCAGGTCGTCTTCACTGCCGCCATTGC
TGGGCACCCATCTGCCTCCTATCCTTCTCTCACCTCTTCTTCTACGTCTCCGTCGCTCAAACTCTCCGTTGCATCAACGG
CTTCAAGTACCAGCGTCGCTGCCATAAGCTCACTCTCGGTCTCGCCACTCACAAGCTCCGTTTCATCAAGTCAAGAATCG
CTGCCGGAGATTTCCTCGGTGGAGGCGACGGTGATGAGGCCTCTGCTGCTGCTTGGGATCTGGAAGTTCCGTATCAAGAA
CCACCTGATAGCTACTTTGGCAAGTTTAAGAGAAATTGGGCTCTCTATTTTGGGTTCTTGATCCTTCTTTACACTTTCAT
GATCTCTTTCTCTGTCGTTATCCTCTGTTTCTGA