Details for Arabidopsis Locus AT3G18790

Position : Chr3 ( 5`- 6477699 .. 6479548 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18790

Protein [Map View]
MARNEEKAQSMLNRFITQKESEKKKPKERRPYLASECRDLAEADKWRQQILREIGSKVAEIQNEGLGEHRLRDLNDEINK
LLRERYHWERRIVELGGHNYSKHSAKMTDLEGNIIDVPNPSGRGPGYRYFGAAKKLPGVRELFEKPPELRKRKTRYDIYK
RIDASYYGYRDDEDGILEKLERKSEGGMRKRSVEEWRRLDEVRKEARKGASEVVSVGAAAAAAREVLFEEEEDVVEEERM
EREKEEEKEREFVVHVPLPDEKEIEKMVLEKKKMDLLSKYASEDLVEQQTEAKSMLNIHR*

DNA
ATGGCTCGTAATGAAGAGAAAGCACAGTCGATGCTCAACAGATTCATCACCCAGAAAGAATCTGAGAAGAAGAAGCCAAA
AGAGCGTCGACCTTACCTCGCATCAGAATGTAGAGATCTAGCTGAAGCAGACAAATGGAGACAGCAAATTTTGAGAGAGA
TCGGTAGCAAAGTAGCTGAGATTCAGAACGAAGGATTAGGAGAGCACAGACTTCGAGATCTAAACGATGAGATTAACAAG
CTTCTCAGGGAGAGATATCATTGGGAGCGGCGAATCGTTGAGCTAGGTGGTCACAATTACTCGAAACATTCGGCGAAGAT
GACGGATCTAGAAGGTAACATAATCGATGTACCTAACCCTAGTGGTCGTGGTCCTGGTTATCGTTACTTCGGAGCTGCTA
AGAAACTTCCTGGTGTTAGAGAGCTTTTTGAGAAGCCTCCTGAGCTGAGGAAGCGTAAAACTAGGTATGATATATATAAA
AGGATTGATGCTAGCTATTATGGGTATAGAGATGATGAAGATGGTATTTTGGAGAAGTTGGAGAGGAAATCTGAAGGAGG
GATGAGGAAAAGATCGGTGGAGGAGTGGCGGAGATTAGATGAGGTTAGGAAGGAAGCTAGGAAAGGTGCTAGTGAGGTTG
TGAGTGTTGGAGCTGCAGCTGCTGCGGCGAGGGAAGTGTTGTTTGAGGAGGAGGAGGATGTTGTTGAGGAGGAGAGGATG
GAGAGGGAGAAAGAGGAGGAGAAAGAGAGGGAATTTGTGGTTCATGTTCCGTTGCCTGATGAGAAGGAGATTGAGAAGAT
GGTGTTGGAGAAGAAGAAGATGGATCTGCTTAGTAAGTATGCTAGTGAAGATTTGGTTGAGCAGCAGACTGAGGCTAAAT
CCATGCTCAATATTCATAGATAG