Details for Arabidopsis Locus AT3G18740

Position : Chr3 ( 5`- 6453368 .. 6454018 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18740

Protein [Map View]
MVAEKKAKKSHEGINSRLALVMKSGKYTLGYKSVLKSLRSSKGKLILISSNCPPLRRSEIEYYAMLAKVGVHRYNGNNVD
LGTACGKYFRVSCLSIVDPGDSDIIKTLPGDQ*

DNA
ATGGTTGCGGAGAAGAAGGCGAAGAAGTCCCATGAAGGAATCAACAGCAGATTAGCTCTTGTGATGAAGAGTGGAAAGTA
CACTCTTGGATACAAGTCTGTTCTCAAATCCCTTCGCAGCTCCAAAGGTAAGCTGATATTGATATCTAGCAATTGCCCAC
CGTTGAGAAGGTCAGAGATTGAATACTATGCGATGCTTGCTAAAGTTGGAGTTCATCGCTACAATGGCAACAATGTTGAT
TTGGGTACTGCTTGTGGTAAATACTTCCGAGTTTCTTGCCTCAGCATCGTTGATCCTGGTGATTCCGACATCATCAAGAC
ACTTCCTGGAGATCAGTGA