Details for Arabidopsis Locus AT3G18720

Position : Chr3 ( 5`- 6444367 .. 6445759 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18720

Protein [Map View]
MRTRRQTYPPIAESLTARSIVQALPASATISGNGGPKKKKNCVNRGLWDKQIPTDLLQEILSRLGLKANIHASLVCKTWL
KEAVSVRKFQSRPWLFYPQSQRGGPKEGDYVLFNPSRSQTHHLKFPELTGYRNKLACAKDGWLLVVKDNPDVVFFLNPFT
GERICLPQVPQNSTRDCLTFSAAPTSTSCCVISFTPQSFLYAVVKVDTWRPGESVWTTHHFDQKRYGEVINRCIFSNGMF
YCLSTSGRLSVFDPSRETWNVLPVKPCRAFRRKIMLVRQVFMTEHEGDIFVVTTRRVNNRKLLAFKLNLQGNVWEEMKVP
NGLTVFSSDATSLTRAGLPEEERNILYSSDIDDFVKSSHPTFYYYDCSAWLQPPHDNFNF*

DNA
ATGAGGACGCGCCGGCAAACATATCCGCCGATCGCTGAATCCCTCACGGCGAGGTCCATTGTTCAGGCGCTTCCGGCGTC
AGCCACAATATCAGGAAATGGTGGACCAAAGAAGAAGAAGAACTGTGTTAATAGAGGATTGTGGGATAAACAGATTCCGA
CGGATCTGCTGCAAGAGATACTGTCTCGCCTCGGATTAAAAGCCAACATACATGCTTCTCTCGTCTGCAAGACATGGCTT
AAAGAAGCTGTTTCTGTCAGGAAGTTTCAGAGTCGTCCTTGGCTTTTTTATCCACAGAGTCAGAGAGGAGGACCAAAAGA
AGGAGACTACGTTCTCTTTAACCCATCACGGTCTCAAACACATCACCTCAAGTTTCCAGAGTTAACGGGCTACAGAAATA
AATTAGCTTGTGCTAAGGATGGTTGGTTGCTTGTGGTAAAAGATAACCCCGATGTGGTCTTCTTTCTTAACCCGTTTACC
GGGGAACGCATCTGCTTACCCCAGGTGCCACAAAATTCCACACGCGATTGCTTAACTTTCTCAGCCGCTCCCACATCAAC
TAGTTGTTGCGTCATATCCTTCACCCCTCAAAGTTTTCTTTACGCAGTTGTTAAAGTTGATACTTGGCGCCCTGGTGAAT
CCGTATGGACCACTCATCACTTTGATCAAAAGCGTTACGGTGAGGTAATCAATAGATGTATCTTCTCCAATGGTATGTTC
TATTGTCTCAGTACCAGTGGCCGCCTCTCGGTTTTCGACCCGTCTAGAGAAACCTGGAATGTTCTTCCAGTGAAACCATG
TCGGGCCTTTCGTCGTAAAATTATGCTTGTGAGGCAAGTATTCATGACAGAGCATGAAGGAGACATCTTTGTTGTGACTA
CACGCCGCGTAAACAACAGAAAACTGTTGGCCTTTAAACTAAACCTTCAAGGCAATGTGTGGGAAGAGATGAAAGTACCT
AATGGCTTGACAGTATTTTCAAGTGACGCTACCTCTTTAACAAGAGCTGGTCTTCCAGAGGAGGAGAGGAACATTCTATA
TTCATCGGATATCGATGATTTTGTGAAAAGCTCTCATCCAACTTTCTATTATTATGACTGCAGCGCTTGGCTCCAGCCAC
CTCATGACAATTTTAATTTTTGA