Details for Arabidopsis Locus AT3G18715

Position : Chr3 ( 5`- 6441067 .. 6441348 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18715

Protein [Map View]
MYPTRPHYWRRRLSINRPQAFLLLILCLFFIHHCDASRFSSSSVFYRNPNYDHSNNTVRRGHFLGFLPRHLPVPASAPSR
KHNDIGIQALLSP*

DNA
ATGTATCCTACACGTCCACATTATTGGAGAAGAAGATTATCAATAAACCGGCCACAAGCTTTTCTTCTTTTGATTCTCTG
CCTCTTCTTCATTCACCACTGCGACGCCTCGAGATTCTCGTCATCAAGCGTTTTCTACAGAAACCCTAATTATGATCATA
GCAATAACACGGTGCGGAGAGGCCATTTCTTAGGATTCTTGCCAAGACATTTACCTGTTCCAGCTTCTGCTCCTTCACGA
AAACACAACGACATTGGTATTCAAGCCTTGTTGTCTCCTTGA