Details for Arabidopsis Locus AT3G18710

Position : Chr3 ( 5`- 6434083 .. 6435561 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18710

Protein [Map View]
MGRDETETYITVPSFFKCPISLDVMRSPVSLCTGVTYDRASIQRWLDGGNNTCPATMQLLKTKDFVPNLTLQRLINIWSD
SIGRRHNGDSPVLNPPSGREVPTKEEVNVLLERLMSLENLMKIVRFVKDSDSNREFLSKKMEFVPMLVDIIRTKKTKIEL
VIMAIRILDSIKVDRERLSNLMLANDGGDCLTAILLAIQRGNLESKIESVRVLDWISFDAKSKLMIAERDGVLTEMMKSI
SITESSDPSLIEASLSFLITISKSKRVRSKLIAAKAITKIKDILLTETLTNVAVTEKSLKLLETLSSKREGRLEICGDDN
GRCVEGVVKKLLKVSTTATEHAVTILWCLCYVFREDKTVEETVERSNGVTKLLVVIQSNCSAMVRQMAKDLIKVLKFNSS
ALAAYETKTTHIMPF*

DNA
ATGGGGAGAGATGAAACAGAGACGTACATTACAGTGCCAAGTTTCTTCAAATGTCCGATATCTCTTGACGTGATGAGATC
TCCGGTTAGTCTCTGTACCGGCGTGACTTATGATCGAGCCAGTATCCAGAGATGGCTCGATGGTGGTAACAACACTTGTC
CCGCTACTATGCAACTTCTCAAAACTAAAGATTTTGTTCCTAACCTCACTCTTCAACGTCTTATCAATATCTGGTCTGAT
TCAATCGGCCGTCGTCACAACGGTGATTCTCCGGTTCTGAATCCGCCGTCTGGTAGAGAAGTTCCGACGAAGGAAGAAGT
GAATGTGTTGTTGGAGAGATTGATGAGTCTGGAGAATTTGATGAAGATCGTTCGATTCGTGAAGGATTCGGATTCGAACA
GAGAGTTTCTCTCGAAGAAGATGGAGTTCGTACCAATGCTCGTTGATATTATACGCACGAAGAAGACGAAGATCGAGTTA
GTTATAATGGCGATTAGGATTTTGGATTCGATTAAAGTAGATCGTGAACGGTTATCGAATCTGATGTTGGCGAATGACGG
CGGAGATTGTTTAACGGCGATTCTCTTAGCGATTCAACGCGGGAATCTGGAATCGAAGATCGAATCGGTTCGGGTTTTGG
ATTGGATCTCCTTCGACGCTAAATCAAAGCTTATGATAGCAGAACGTGACGGAGTTTTAACAGAGATGATGAAATCGATA
AGTATCACTGAGTCGTCAGATCCGAGTTTGATCGAAGCGAGTTTATCGTTTCTAATCACAATCTCCAAATCAAAACGAGT
GAGATCGAAACTAATCGCTGCAAAAGCAATCACGAAGATCAAAGACATTCTTCTGACGGAGACGTTAACAAACGTTGCCG
TGACGGAGAAGTCGTTGAAGCTGTTAGAGACTTTATCGTCAAAGCGAGAAGGGAGATTGGAGATTTGTGGAGACGACAAT
GGTAGATGTGTGGAAGGAGTGGTGAAGAAGCTCTTGAAAGTATCGACGACGGCGACGGAACACGCCGTGACGATTTTGTG
GTGTTTGTGTTATGTTTTCAGGGAAGATAAGACGGTGGAAGAGACGGTGGAGAGAAGTAACGGAGTTACGAAGCTGTTAG
TGGTGATACAGAGCAATTGTTCGGCGATGGTTAGACAAATGGCGAAAGATTTGATTAAAGTGTTGAAGTTTAATTCCTCT
GCTTTGGCTGCTTACGAGACCAAGACTACTCATATTATGCCTTTTTGA