Details for Arabidopsis Locus AT3G18690

Position : Chr3 ( 5`- 6429534 .. 6430514 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18690

Protein [Map View]
MDPSEYFAGGNPSDQQNQKRQLQICGPRPSPLSVHKDSHKIKKPPKHPAPPPNRDQPPPYIPREPVVIYAVSPKVVHATA
SEFMNVVQRLTGISSGVFLESGGGGDVSPAARLASTENASPRGGKEPAARDETVEINTAMEEAAEFGGYAPGILSPSPAL
LPTASTGIFSPMYHQGGMFSPAIPLGLFSPAGFMSPFRSPGFTSLVASPTFADFFSHIWDQD*

DNA
ATGGATCCGTCGGAGTATTTTGCCGGCGGCAATCCTTCCGATCAACAGAACCAGAAGCGGCAGCTTCAGATCTGTGGTCC
TCGTCCTTCACCTCTTAGTGTTCACAAAGACTCTCACAAAATCAAGAAACCTCCAAAACACCCTGCGCCGCCGCCAAATC
GTGACCAACCGCCGCCGTATATTCCTAGAGAGCCGGTGGTTATCTACGCCGTATCCCCCAAGGTTGTACACGCAACCGCG
TCTGAGTTCATGAACGTAGTCCAGCGACTCACAGGGATCTCCTCTGGTGTTTTCCTCGAATCTGGCGGCGGTGGAGATGT
TTCACCGGCGGCGAGGCTAGCGTCCACGGAAAATGCTAGTCCAAGAGGAGGAAAAGAACCGGCTGCGAGAGATGAGACGG
TGGAAATCAACACGGCTATGGAAGAAGCAGCTGAATTTGGTGGTTATGCTCCGGGAATACTCTCGCCATCTCCGGCCTTG
TTGCCAACAGCTTCTACCGGGATATTCTCTCCGATGTATCATCAAGGTGGGATGTTTTCGCCGGCTATACCACTGGGATT
ATTCTCGCCGGCGGGATTTATGAGCCCGTTTCGAAGTCCTGGCTTTACTAGTTTGGTAGCTTCACCAACTTTTGCTGATT
TCTTTAGTCATATTTGGGATCAAGATTAG