Details for Arabidopsis Locus AT3G18680

Position : Chr3 ( 5`- 6427403 .. 6429692 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18680

Protein [Map View]
MAIPLPLTSCSPISTSSSISRTSFVPLTLRNRTFFSNQNYSRRVLISCSSSLSSDNGSSPDSMNGNGNGNGSSLNGQSSF
PRLPSFDGTSKPPLKWRRVLLKVSGEALAGDEEQNIDPKVTMAIAREVAAVTRLGIEVAIVVGGGNIFRGSTWAGCSGLD
RSSADYIGMLATVMNAIFLQATMESIGIPTRVQTAFRMSEVAEPYIRRRAIRHLEKGRVVIFAAGTGNPFFTTDTAAALR
CAEINAEVVLKATNVDGVFDDDPKRNPNARLLDSLTYQEVTSKDLSVMDMTAITLCQENNIPVVVFNLSEPGNIAKAIKG
ERVGTLIGGTWNSIVTTTS*

DNA
ATGGCAATTCCGTTGCCTCTTACCTCTTGCTCCCCAATCTCAACTTCTTCGTCTATTTCCCGAACCTCCTTCGTCCCTCT
TACACTTCGCAATCGTACTTTCTTCTCCAACCAGAATTACAGTAGGCGTGTACTTATCAGCTGCTCTTCTTCTTTGTCCT
CAGACAATGGTTCATCTCCAGACTCCATGAACGGAAACGGGAACGGGAACGGGAGTAGCTTAAACGGGCAATCATCTTTC
CCACGACTGCCTTCCTTTGATGGAACATCCAAACCACCGCTTAAATGGAGAAGGGTTTTACTCAAAGTCAGTGGAGAAGC
TCTTGCTGGAGACGAGGAGCAAAATATCGACCCAAAGGTTACTATGGCGATTGCAAGGGAAGTTGCAGCAGTGACTCGAC
TTGGCATTGAGGTTGCTATAGTTGTTGGAGGAGGAAATATCTTTCGTGGATCTACCTGGGCTGGGTGCAGTGGCCTTGAT
CGCTCCTCTGCTGATTATATCGGGATGCTGGCAACTGTGATGAATGCAATATTTCTTCAAGCGACAATGGAGAGTATTGG
CATCCCAACCCGTGTTCAAACTGCTTTCCGCATGTCGGAAGTCGCAGAGCCTTACATAAGAAGACGAGCAATCAGACATC
TAGAAAAAGGAAGGGTTGTAATATTTGCAGCTGGAACAGGCAATCCATTTTTCACCACCGATACTGCAGCGGCTCTTCGA
TGTGCTGAAATTAATGCAGAAGTAGTGCTGAAAGCAACAAATGTTGATGGCGTGTTCGACGATGATCCTAAAAGAAACCC
AAACGCTCGTCTGCTTGACTCACTAACTTACCAAGAGGTCACCTCAAAGGACCTCTCTGTAATGGATATGACTGCTATCA
CTTTGTGCCAAGAAAATAACATCCCAGTTGTGGTATTCAATCTTTCGGAACCTGGGAACATCGCCAAAGCAATCAAAGGA
GAGAGAGTTGGTACATTGATAGGAGGAACTTGGAACTCCATTGTTACAACAACCTCATGA