Details for Arabidopsis Locus AT3G18660

Position : Chr3 ( 5`- 6419031 .. 6422002 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18660

Protein [Map View]
MANSPAAPAPTTTTGGDSRRRLSASIEAICKRRFRRNSKGGGRSDMVKPFNIINFSTQDKNSSCCCFTKFQIVKLLLFIL
LSATLFTIIYSPEAYHHSLSHSSSRWIWRRQDPRYFSDLDINWDDVTKTLENIEEGRTIGVLNFDSNEIQRWREVSKSKD
NGDEEKVVVLNLDYADKNVTWDALYPEWIDEEQETEVPVCPNIPNIKVPTRRLDLIVVKLPCRKEGNWSRDVGRLHLQLA
AATVAASAKGFFRGHVFFVSRCFPIPNLFRCKDLVSRRGDVWLYKPNLDTLRDKLQLPVGSCELSLPLGIQDRPSLGNPK
REAYATILHSAHVYVCGAIAAAQSIRQSGSTRDLVILVDDNISGYHRSGLEAAGWQIRTIQRIRNPKAEKDAYNEWNYSK
FRLWQLTDYDKIIFIDADLLILRNIDFLFSMPEISATGNNGTLFNSGVMVIEPCNCTFQLLMEHINEIESYNGGDQGYLN
EVFTWWHRIPKHMNFLKHFWIGDEDDAKRKKTELFGAEPPVLYVLHYLGMKPWLCYRDYDCNFNSDIFVEFATDIAHRKW
WMVHDAMPQELHQFCYLRSKQKAQLEYDRRQAEAANYADGHWKIRVKDPRFKICIDKLCNWKSMLRHWGESNWTDYESFV
PTPPAITVDRRSSLPGHNL*

DNA
ATGGCAAACTCTCCCGCTGCTCCTGCACCCACCACCACAACCGGTGGTGACTCCCGGCGACGCCTCTCCGCGTCCATAGA
AGCAATATGCAAGAGGAGATTCCGGAGAAATAGCAAAGGAGGTGGCAGATCGGATATGGTGAAACCGTTTAATATCATAA
ATTTTTCGACACAAGACAAAAACAGTAGTTGTTGTTGTTTCACCAAGTTTCAGATCGTGAAGCTTCTCTTGTTTATCCTT
CTCTCTGCCACTCTCTTCACCATTATCTATTCTCCTGAAGCTTATCATCATTCTCTTTCCCACTCATCTTCTCGATGGAT
ATGGAGAAGACAAGATCCACGTTACTTCTCGGATCTGGATATAAACTGGGACGATGTGACTAAAACCCTTGAGAACATCG
AAGAAGGCCGTACGATCGGTGTCTTGAATTTTGATTCGAACGAGATCCAACGATGGAGAGAAGTATCCAAGAGCAAGGAC
AATGGGGATGAAGAAAAAGTTGTTGTATTGAATCTAGATTACGCAGACAAGAATGTGACTTGGGACGCACTATATCCAGA
GTGGATCGATGAGGAGCAAGAAACAGAGGTCCCTGTTTGTCCTAATATCCCGAACATTAAGGTACCTACAAGAAGACTCG
ATCTGATCGTCGTGAAACTTCCTTGTCGGAAAGAAGGGAATTGGTCGAGAGACGTCGGGAGATTGCATCTACAGCTAGCG
GCTGCAACTGTGGCGGCTTCGGCCAAAGGGTTTTTCAGGGGACATGTGTTTTTTGTATCTAGATGCTTTCCGATTCCGAA
TCTTTTCCGGTGTAAAGATCTTGTGTCTCGGAGAGGCGATGTTTGGTTGTACAAACCTAATCTTGATACCTTGAGAGACA
AGCTTCAGCTGCCTGTAGGGTCTTGTGAGCTATCTCTTCCTCTTGGCATCCAAGATAGGCCAAGCTTAGGAAACCCTAAA
AGAGAAGCTTACGCAACAATTCTTCACTCAGCTCACGTTTACGTCTGCGGTGCAATCGCCGCGGCTCAGAGCATAAGACA
GTCTGGTTCGACGAGAGACCTTGTTATCCTTGTTGATGACAACATCAGCGGTTACCACCGGAGTGGACTAGAAGCCGCGG
GTTGGCAAATCCGGACGATACAGAGGATTCGAAACCCTAAGGCAGAGAAAGATGCTTACAACGAATGGAACTACAGCAAG
TTCCGGCTATGGCAGCTGACTGATTACGACAAAATCATTTTCATCGACGCGGATCTCTTAATCTTGAGAAACATCGATTT
CTTGTTCTCGATGCCTGAGATCTCAGCTACAGGAAACAATGGAACTCTGTTTAATTCAGGAGTTATGGTGATCGAGCCTT
GCAACTGTACGTTTCAGCTTCTGATGGAACATATAAACGAGATTGAGTCTTATAACGGTGGAGATCAAGGTTACTTAAAC
GAGGTATTCACATGGTGGCACCGGATTCCAAAACATATGAATTTCTTGAAGCATTTTTGGATTGGCGATGAAGATGACGC
GAAACGCAAGAAAACAGAGCTTTTTGGAGCAGAGCCTCCTGTTCTTTATGTTCTTCATTACCTTGGGATGAAGCCGTGGT
TATGTTACCGTGACTACGACTGTAACTTCAACTCCGACATATTCGTTGAGTTTGCTACCGATATCGCTCATCGAAAATGG
TGGATGGTCCACGACGCCATGCCACAGGAACTTCACCAATTCTGTTACTTGCGATCCAAGCAAAAGGCACAGCTGGAATA
TGATCGCCGGCAAGCAGAGGCCGCAAATTATGCCGACGGTCATTGGAAAATAAGAGTAAAGGACCCGAGATTCAAAATTT
GCATCGACAAATTATGTAATTGGAAAAGTATGCTGCGGCATTGGGGCGAATCAAATTGGACTGACTACGAGTCTTTTGTT
CCCACCCCACCAGCCATTACCGTAGACCGGAGATCATCACTTCCCGGCCATAACTTGTGA