Details for Arabidopsis Locus AT3G18650

Position : Chr3 ( 5`- 6417344 .. 6418504 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18650

Protein [Map View]
MASSSSSSLSFSTSKKNKTFFKKPNSAFSSSRATSLIKRQQTVFKKAKELSILCDIDVCVICYGSNGELKTWPEEREKVK
AIARRYGELSETKRRKGSVDLHEFLEKMNKDDPEKEEKKKIKVRRVPKVKYPVWDPRFDNYSVEQLMGLVQSLERNLTRI
QHRTCAVVEAQGQRRVQYTNMANQELMMANTMNQLQQHSNQVSMYLWNHGNGAFSQIPVSALASNQTQSLAPIPPELMIY
PNSDAGNYSGSLGVQGTGINGLQNMNMLTYNNINSVNDFSKQFDQNSRAESYSSLLGVHEDGNNEFENPNMSSRNNFNVQ
DCAGLLGMQGAGTNGLQSMNMHDYSNNNSINSNGLSHQYVQFPTYNSQHQDRVFNLDQNGNNTRSL*

DNA
ATGGCTTCTTCTTCGTCCTCTTCTCTTTCGTTTTCAACATCGAAGAAGAACAAAACCTTTTTCAAGAAACCTAATTCTGC
TTTTTCTTCTTCGAGGGCCACAAGTTTGATCAAAAGACAACAGACTGTCTTTAAGAAAGCTAAAGAGCTTTCAATTCTCT
GTGACATCGATGTCTGCGTCATCTGTTACGGATCAAACGGAGAGCTTAAGACATGGCCTGAAGAGAGAGAGAAGGTCAAA
GCCATAGCTCGAAGGTACGGTGAATTAAGCGAGACGAAGCGTCGCAAAGGAAGCGTTGATCTTCACGAGTTCCTCGAGAA
GATGAACAAGGATGATCCCGAGAAGGAGGAGAAGAAGAAGATTAAAGTGAGACGTGTACCCAAAGTCAAGTATCCAGTTT
GGGACCCTAGGTTTGACAATTACTCTGTGGAGCAACTCATGGGACTGGTTCAGTCCTTGGAACGAAACCTAACCAGGATC
CAACATAGGACTTGCGCTGTTGTTGAAGCTCAGGGGCAGAGGAGGGTACAGTACACGAACATGGCTAATCAAGAACTGAT
GATGGCTAATACGATGAATCAACTTCAACAACACTCAAACCAGGTTTCCATGTATCTGTGGAACCATGGAAACGGTGCTT
TCTCACAAATCCCAGTCTCAGCATTGGCTTCAAACCAAACGCAATCTCTAGCTCCGATTCCGCCTGAACTGATGATTTAC
CCGAATTCGGATGCGGGAAATTACTCGGGGTCTCTCGGGGTACAAGGAACTGGGATCAATGGGCTTCAGAACATGAACAT
GTTAACCTATAACAACATCAACAGCGTTAATGATTTCTCAAAACAGTTTGACCAGAATTCCAGAGCGGAAAGTTACTCTA
GCTTACTTGGGGTACACGAAGACGGAAACAATGAGTTTGAGAACCCTAACATGTCCAGCCGCAACAACTTCAATGTTCAA
GACTGTGCAGGGTTACTTGGGATGCAAGGAGCTGGAACTAACGGGTTGCAGAGCATGAACATGCATGACTACAGTAACAA
CAACAGCATTAACTCTAATGGTCTTTCGCATCAGTATGTTCAATTTCCAACGTACAACAGCCAACATCAGGACCGGGTTT
TCAATTTGGATCAAAACGGAAACAATACTAGGTCTCTCTAA