Details for Arabidopsis Locus AT3G18640

Position : Chr3 ( 5`- 6413301 .. 6416550 -3` )
Annotation :
External links : SALK TAIR PlantTribes CoGe
PGDD synteny : AT3G18640

Protein [Map View]
MEMSGLGRKRVSKWDSKEDTHHHHSSVNANSASYYRDKESEPVRFNAESNGEARTRSRVSQNNDNSYFSEQDGTRQQFVR
RSGSRSNSRSRSRSRSPVYRARRDAGSYDRHKTRTQVSPTPIREFNKRGSDHLFDQSRSDHYGWEDNIRKPRETKYHTDD
FREEAMMEGARSSDYNNTDYPEDNSRIRRRRSEFTGEKETQRRDGGDGEGGFHRSSNIPCKFFAAGTGFCRNGKYCRFSH
HVADRKQPQDNNNNFYRQDNNNHTSGHNKWNDVERLDNGRVGGIEVSRASKKGVSESKGNGSSSWIDDMEMSPDWNYGVQ
ALKKPVKEDHSVGIIGQSSQSRVLKDDQRSSGMFSHGGRTMAEKPVAASHQSYSNSVNVAPVETFNQNHNALPYQSSLTA
GGSQQVLAAAATNFSVGSNLSNLESGKVYQDNHHSTVEKPVLVQNTVSREQIDQITNISASLAQFLANGQPIPQLEQALQ
LPLHSESVQPNQATTQSNVVSSNPNQLWGLGMSTGAEGVPAVTASKISNVEEIQEVSLDPKENGDKKTDEASKEEEGKKT
GEDTNDAENVVDEDEDGDDDGSDEENKKEKDPKGMRAFKFALVEVVKELLKPAWKEGKLNKDGYKNIVKKVAEKVTGTMQ
SGNVPQTQEKIDHYLSASKPKLTKLVQAYVGKIKKT*

DNA
ATGGAAATGAGTGGTCTGGGAAGAAAACGTGTTTCAAAGTGGGACTCTAAGGAAGACACACACCATCATCATTCTAGCGT
AAATGCAAACTCGGCTTCTTATTACCGCGACAAAGAGTCTGAGCCTGTCCGGTTCAATGCAGAGAGTAACGGTGAAGCTA
GGACTAGAAGCAGAGTTTCACAGAATAACGATAACAGTTATTTTTCTGAACAAGATGGTACTAGGCAACAGTTTGTCCGT
AGGAGTGGAAGTAGAAGTAATAGCAGGAGTAGAAGCCGTAGTAGAAGCCCAGTCTATAGAGCTAGACGAGACGCGGGATC
TTATGACAGACACAAGACGAGAACACAAGTTTCTCCTACGCCAATCAGAGAATTCAATAAGAGAGGCAGTGATCATTTGT
TTGATCAAAGCAGAAGTGATCATTATGGTTGGGAAGATAACATTAGAAAGCCGAGGGAGACCAAATATCACACCGATGAT
TTCAGAGAAGAGGCAATGATGGAAGGTGCAAGGTCTTCTGACTATAATAATACTGATTATCCCGAGGATAATTCGAGAAT
AAGAAGGCGAAGAAGCGAGTTTACGGGAGAGAAGGAAACACAAAGAAGGGATGGTGGTGATGGTGAAGGAGGATTCCACA
GGAGTTCGAATATTCCGTGTAAGTTTTTCGCTGCGGGGACGGGGTTCTGTCGTAATGGCAAGTATTGCAGGTTTTCTCAT
CATGTTGCTGATAGAAAACAGCCTCAAGACAACAACAACAACTTTTATAGACAGGACAATAACAATCATACTAGTGGTCA
TAATAAATGGAATGATGTTGAAAGATTGGACAATGGAAGAGTAGGCGGAATCGAAGTTTCTCGTGCCAGTAAGAAGGGAG
TTTCTGAATCTAAAGGGAATGGTAGTAGTAGCTGGATTGATGACATGGAGATGTCTCCTGATTGGAATTATGGAGTCCAA
GCTTTAAAGAAGCCTGTGAAGGAAGACCATAGTGTTGGTATTATTGGTCAGAGTTCACAATCTCGAGTTCTTAAAGATGA
TCAGAGGAGTAGTGGTATGTTTTCACATGGTGGCAGAACTATGGCTGAGAAACCTGTAGCTGCTTCACATCAGAGTTACA
GTAATTCAGTGAATGTTGCGCCAGTTGAAACATTCAATCAGAATCATAATGCATTACCGTACCAAAGCTCACTAACTGCT
GGAGGAAGTCAACAAGTGCTAGCTGCTGCTGCTACAAATTTCTCAGTAGGCTCCAACTTGAGCAATCTTGAGAGTGGAAA
AGTTTATCAAGATAATCATCACTCAACTGTGGAGAAACCTGTTTTGGTCCAAAATACAGTAAGTAGGGAACAAATCGATC
AGATTACTAACATCTCAGCATCTCTAGCGCAGTTTCTTGCAAATGGTCAGCCCATTCCACAGCTTGAACAGGCATTGCAG
CTGCCTCTGCATTCAGAATCTGTTCAACCAAATCAGGCTACTACTCAAAGTAATGTAGTGAGTAGTAATCCAAATCAGCT
ATGGGGATTAGGGATGAGCACTGGCGCTGAAGGAGTCCCCGCGGTTACTGCATCAAAGATAAGCAATGTCGAAGAGATTC
AAGAAGTATCGCTAGATCCCAAGGAAAACGGGGACAAAAAGACTGATGAAGCTAGCAAGGAAGAAGAGGGTAAGAAAACT
GGAGAAGACACTAATGATGCTGAGAATGTCGTGGATGAAGATGAAGATGGTGATGATGATGGGAGCGACGAAGAGAACAA
GAAAGAGAAAGACCCGAAAGGAATGCGGGCGTTTAAGTTTGCTTTAGTTGAGGTTGTAAAAGAGCTTTTAAAACCAGCTT
GGAAAGAAGGTAAGCTGAACAAAGATGGTTACAAAAACATAGTGAAGAAGGTAGCTGAGAAAGTGACTGGTACAATGCAA
AGTGGAAACGTTCCTCAAACACAGGAGAAGATTGACCATTATCTATCCGCTTCGAAACCAAAGCTTACCAAGCTCGTTCA
GGCATATGTCGGCAAAATCAAGAAGACCTAA